Cherry SNP DataBase

Gene information

Gene Pav_co3990857.1_g010.1.mk
Chromosome name PAV_r1.0chr0
start 140248862
end 140249751
PAV_r1.0 name Pav_co3990857.1
start 102
end 991
direction -
Annotation NR PREDICTED: gelsolin-related protein of 125 kDa-like
Sequence CDS ATGATCTCGCTGAATGAAGAAGGAAATGAGGAGGCAACAGAAACAGAGAAGCAGCCAGAA CCATCGGAGACTGAAAAGCCTCTGGAGGAACAGAAGGCTGAGCCTGCAGAGATAGCCATT GAAGATGCACCGGAACCAGAGACCAAAACCAAACAACCATCTGAAGAAAAAGTTACAGAA GAAGTGAAGGAAGTTGCTGAAGCAGCAACGGAGGAAGTGAAAGGAACCGTCGCAGAAAAT AGTGCAGAAGAAGGTAAAGATGTTGAAGTGAAGGGAGGCGCTGCTGAAGGGCATGCCAAA GTATGA
PEP MISLNEEGNEEATETEKQPEPSETEKPLEEQKAEPAEIAIEDAPEPETKTKQPSEEKVTE EVKEVAEAATEEVKGTVAENSAEEGKDVEVKGGAAEGHAKV


| Top |