Cherry SNP DataBase

Gene information

Gene Pav_sc0000006.1_g320.1.mk
Chromosome name PAV_r1.0chr7
start 3396462
end 3403877
PAV_r1.0 name Pav_sc0000006.1
start 131895
end 139310
direction +
Annotation NR PREDICTED: protein kinase and PP2C-like domain-containing protein
Sequence CDS ATGGGGCTTGAAATTATGGAACCCAACGCGTGCATTAGAGGTTGCTGCAGCAGCAATTCC ATTCCTCTCCATCTTCCACCTTCCTCTTACACTCTCCTCAAACCAATTGCCAGAGGGGCT GAGAGTGTTGTATATGAAGCAATTTTGGATGGAAAGAAAGTTGCTGTGAAGAAACCCATC TTGGCTACTTCTGAGGATCTTGATAAGTTCCACAAGGAGCTGCAATTGCTATGTAAGCTT GATCATCCGGGAATAGCAAAACTGGTTGCCGCACATGCAAAGCCACCCAATTACTTGTAT TTCTTCGAATTATTTGAGCCTCCAAACTTATCTGAGAAATTACACATGGAAGAATGGAGT CCGAACATCAATCAGGTGCTTGTGGTTGCTGTCCAATTAGCAAAGGCTTTGCAATATCTG CATCACCTTGGGATTGTACATAGGGATGTGAAACCGGCAAATATTCTTCTGGACAAAGAT CTTTATCCACACTTATCAGACTTTGGTTTGGCTGAGTACAAGAAAGACCTTAAAGGAGTT TCTATTGGGAATTGGAGGTCATCTGGAAAACCTACTGGTGGTTTCCACAAAAAAAACATG GTTGGCACACTCATTTACATGGCACCTGAAATACTAAAGAAGGAAATACATACAGAAAAA TCAGATGTCTACAGCTTTGGTATATCAATTAATGAGCTTCTTACTGGTGTTGTTCCATAT ACTGATCTTCGTGCGGAAGCTCAGGCACACACTGTACTGGAGATGAACTACACTGAACAG CAACTAACAGCAGCTGTGGTGTCCGATGGATTGCGACCTGTTCTTGCTGGTCCTGAATCT GGTGCACCATCTACTTTGTTGTCACTGATAGAGAGGTGTTGGGATGCAAATTCACAAAAC AGACCTTCTTTCGATGACATAGTTGCAGAACTTGGTACAATTTTGGAACAGAGAGAAAAT ATAAAAGAATCGGATATTGTCTTTCCCAAATCTTCTAATTCTCTTGGTGATCAGCCAGTA GATGTTGCTAGCAGCCTTCAAGCATACCAAGAGGGTATTAACTGGTTTACTCAGGGAGAA AATTTCATCACGAGAGCTTGTCTACCTAAACCTGGTACAGCAATCTGGCTTGCATCAAAT GATCCTTTGGCATATAATCCAGTACTTTCTTGGGGATCCTTTGCTACATGCGGGAGACGG GAGACCATGGAGGACACTCATTTCCTTTTGCCTCAAATGTTTCATCAAGGGGACATACAT GCTTTTGGTATCTTTGATGGTCATAGAGGTGCAGCAGCTGCCGAATTTTCAGCTCGAGCA TTTCCAGGATTCTTGCAAGCTTTAAGTTCAACTAGCAGTCCAAGTGGTGCATTATTCGAA GCATTCATTAAGACAGATATTGCATTTAGAGCTGAGCTGGATTTTTCTCGTAAATCCAAA AGAGTTATCCAGAAGGACTGGCATCCCGGTTGCACTGCAGCAGCTGCTCTTATTGTTGGA AGCAAGCTTTTTGTGGCTAATGCTGGTGATTGCAGGACCATAATGTGTCGGGCTGGCCAT CCCTTTGTTCTAAGCAAGGGGAACGGGACTTCTTACATTCCTGATCATGTTGCAAGCTGT CTTGAGGAGAGGGAGCGGGTTATTAGTGCTGGGGAACAAGTTAGATGGCAAGTAGATAAT TGGCGGGTGGGTCTTGCTGCTCTTCAGGTCACTCGTTCCATAGGGGATGATGATCTAAAG CCTGCTGTAACCGCAGAACCTGAGATAACTGAAACTATTCTTTCGGCAGAGGATGAGTAT TTGTTAGGTTTTGGAAAGAATATAACATGA
PEP MGLEIMEPNACIRGCCSSNSIPLHLPPSSYTLLKPIARGAESVVYEAILDGKKVAVKKPI LATSEDLDKFHKELQLLCKLDHPGIAKLVAAHAKPPNYLYFFELFEPPNLSEKLHMEEWS PNINQVLVVAVQLAKALQYLHHLGIVHRDVKPANILLDKDLYPHLSDFGLAEYKKDLKGV SIGNWRSSGKPTGGFHKKNMVGTLIYMAPEILKKEIHTEKSDVYSFGISINELLTGVVPY TDLRAEAQAHTVLEMNYTEQQLTAAVVSDGLRPVLAGPESGAPSTLLSLIERCWDANSQN RPSFDDIVAELGTILEQRENIKESDIVFPKSSNSLGDQPVDVASSLQAYQEGINWFTQGE NFITRACLPKPGTAIWLASNDPLAYNPVLSWGSFATCGRRETMEDTHFLLPQMFHQGDIH AFGIFDGHRGAAAAEFSARAFPGFLQALSSTSSPSGALFEAFIKTDIAFRAELDFSRKSK RVIQKDWHPGCTAAAALIVGSKLFVANAGDCRTIMCRAGHPFVLSKGNGTSYIPDHVASC LEERERVISAGEQVRWQVDNWRVGLAALQVTRSIGDDDLKPAVTAEPEITETILSAEDEY LLGFGKNIT


| Top |