Cherry SNP DataBase

Gene information

Gene Pav_sc0000012.1_g360.1.mk
Chromosome name PAV_r1.0chr2
start 10862314
end 10877605
PAV_r1.0 name Pav_sc0000012.1
start 168648
end 183939
direction +
Annotation NR hypothetical protein PRUPE_ppa000047mg
Sequence CDS ATGGATATAGAGTTTGAGGCGAGGGTGAAACCTCTGGAATACAAAGTGAAGGCAATGTCA CGTGAGTCGCCGTCCCAGAAGGCGGGTCACGTGCTCGACGCCGACCTCCGCTCCCACTGG TCCACCGCTACCAACACCAAGGAGTGGATTCTTCTCGAGCTCAACGAACCTTGCTTGTTA TCGCACATACGAATTTACAATAAGTCTGTGCTCGAATGGGAAATTTCAGTTGGCTTACGC TACAAGCCAGAGACATTTGTAAAAGTTCGCCCACGTTGTGAAGCACCGCGACGTGACATG ATCTATCCCATGAACTATACTCCCTGTCGCTATGTGCGAATATCTTGTTTGAGGGGAAAT CCCATAGCTATTTTCTTCATACAGCTTATCGGGGTTTCAGTGACTGGCCTGGAACCAGAG TTTCAACCAGTTGTTAACCACTTGTTGCCATCCATTATATCTCACAAACAAGATGCCCAT GATATGCATCTTCAGTTGCTTAAAGACATGACAAGTCGGTTGCTTGTGTTCCTTCCCCAA CTTGAGGCAGACCTTAACAACTTCTTGGATGCTGCTGAACCAAATTTACGTTTTCTTGCT ATGCTTGCCGGTCCTTTTTATCCCATACTTAATCTTGGGCATGAAAGGACAGCTGCAAAG TCTTCAGGCAATATCTCAGACTCTGAAGTTTCTAAACATAGTCAGCCGTCATCAGCCTTA ACCGTGTCTTCTAACTTTGAGCCACGAAGATCACGCGGCACTTCACCTTTCGTCCTGTCA ACATCCAGTTCTATAGTATTCCGTGCAGATGCAATTTTTGTGCTGTTGAGAAAGGCATAT AAAGATTCTGATTTAGGAATTGTTTGCAGAATGGCTGCTAGAGTTCTGCATAAGCTTATA GAGCCTGTGGCACATGAAGGATCAACACCTCCTGGTGAAGTGACATATGGAGATGAAGCA GTAAAATCAGAAATAACTAATCCAGCTCCTTTAGTTGATTACTCAAACTTGTTTGGAGAA GAGTTCCAGTTGCCTGGTGATCACTGGGACTCAAGCTATCTTAACATCTTGGATATAGGA GCAGTGGAGGAAGGGATTTTACATGTTCTTTATGCTTGTGCGTCACAGCCTCAGCTCTGC AGCAAATTAGCAGATAGAACTTCTGACTTCTGGTCTGCGTTACCGCTAGTTCAAGCATTA CTGCCAGCACTTCGTCCCTCTGTTAGCCGTCCGTCTGACATTGTTGATGATAGTTTCTCT CAATGGAAACAACCAATTGTTCAACAAGCCCTCTCCCAGATTGTAGCAACATCGTGTTCA TCATTATACCGTCCACTTCTTCATGCTTGTGCTGGCTATTTATCATCATATTCACCATCA CATGCTAAGGCTGCATGTGTTTTGATTGATCTCTGTTGTGGCGTGCTAGCACCTTGGCTA AGTCAAGTGATTGCAAAGGTTGATCTGGCTGTAGAGCTTCTAGAGGATCTTTTGGGTGTA ATTCAGGGTGCTCGCCACTCCCTGCTTCGTGCTCGTGCTGCCTTAAAATACGTTGTTCTG GCTCTCTCTGGTCACATGGATGATATGCTAGGAAAGTATAAGGAAGTTAAGCATAGGATA CTCTTTCTTGTGGAGATGCTAGAGCCTTTCCTTGATCCTGCTGTAGGAAGATTGAAGGGA ATAATAGCCTTTGGAGATCTGTCTTCTGCACATCCAGAAAAGCAGGAAGAGAATTGTGTT ATTGCCCTCAATGTAATTCGCACGGCAGTGCAGAAACCAGCAGTTCTTCCTTCACTGGAA TCTGAATGGAGGCGTGGATCAGTTGCTCCTAGTGTGCTACTCTCAATATTGGAACCTCAC ATGCAGCTACCTCCTGAAATTGACCTTCGAACATCTCCTGTCCCTAGAGCACTGGAACCT GAATCTTTATCTGGTTTATCTCATTCTTCAGCTTCTCACCATGGGGTAGCTTCAAAATCA AATAGCCAGGATGAATTTGACGGGAAGATAGATGTTTCTGATACAGCCGTAAAAATTGAC ATTTCAGAAGACGCCAGTCTTCTTTTTGCACCTCCAGAACTGCATAACATTGTATTGACA AGTGTATCCAGTTGTCCCAACGAGAACATTTCTGTCTCTAACCATGGGGATTCTGGCTCT GAACCAAAACATCTGGTCGGGAAACATTTTCCACAGAGGTTTCAAATTGACTTAAAACTA GATGCTGGTTTCTCTGCGGAATATTTCAACTTGCAAGCAGATTATTTCCAACTTATAACC TATCAAGACTGCGAGCTCAGGGCTTCTGAATTTCGGCGATTGGCCTTAGATTTGCATTCA CAGAATGAGATTACCATTGAGAGTCATGATGCTGCTATAGATGCTTTGCTCTTGGCTGCA GAGTGCTATGTCAATCCATTTTTTATGATGTCTTTTAGAGGAAATCCAAAGTTAATGAAG GAGATAAACGTCAGTGGGATTAGGAATCCACAAAATCATGAAATTGGGATGCGAATGGTC TCTGGAAAGTCTAAGAATGACCTAGAAACAATATCTCTTCTTGAAAGGAAAAGAGACAAA ATTGTTCTTCAAATTCTGCTCGAGGCTGCAGAGTTAGACAGAGAGTATCGAGAAAAGGTT TCAGATAGAGGACTTAGTCCGTACTACACCGTAGGATTTGATGAACAAGTCATTAGGTTG TGTCCACTTGATGTACAATCTGCGGATGCCATCACCTTGGTTCGACAAAATCAAGCTTTG TTGTGCTGCTTTCTGATTCAACGATTGCAAAGGGAGCAGCACTCGATGCATGAAATTCTT ATGCAGTGTATGATATTCTTGTTGAATTCTGCGACTAAGCTATACTGTGCTCCTGAACAT GTGATTGACATTGCATTAGGATCCGCTGAGTACTTAAATGGGATGCTAACATCCCTGTAT TATCAGTTCAAAGAAAACAATCTGCAGTTGGAGCCAGAAACAATACATGGGATACAACGA CGGTGGATACTGCTTCAAAGATTGGTAATTTCTTCAAGCGGTGGCGATGAGGAAACAGGC TTTGCAATCAATAAAAATGGTTTCCGTTATGGAAATCTGATTCCACCTTCAGCCTGGATG CAGAGGATTTCAACTTTTTCTAGATGCACATCACCTCTTGTTCGATTTCTTGGTTGGATG GCAGTATCTCGTAATGCAAGACAGTACATGAAGGACCAGCTTTTACTTGCTTCTGATCTA CCACAGCTGACATCTCTATTGTCTACATTTGCAGATGAACTTTCTGTTGTAGATAATGTT GTCAGTCGAAAATATGAAGAATCAGGGGGCGAAATTGTTTCTGTACCCATTAAAGGATTT GAAGTTGCTGATCAGCAGCATCAGGACCAATCTTTTCGTGTCATTTACCCTGATCTCTTT AAGTTCTTTCCTAATATGAAAAAGCAATTTGAAGCTTTTGGAGAAACCATTTTGGAGGCT GTTGGGTTGCAGTTGAGGTCTCTTCCTTCCAGTATGGTGCCCGATATTTTGTGTTGGTTC TCTGATTTGTGTTCATGGCCATTTCTACATACAGAGCAGCTTTCTGCTCGAAATAGTTCT GACCTTTTGAAAGGCTATGTTTCAAAGAATGCCAAAGCAATCATCCTCTATACACTTGAA GCCATTGTAACCGAGCACATGGAAGCAATGGTGCCCGAGATACCTAGAGTGGTGCAAGTG CTGGCATGTCTTTGTAGGGCATCTTACTGCGATGTGTCATTTCTTGATTCTGTATTGTCT TTGTTGAAACCAATCATTTCATATTCTTTATATAAGGTGTCTGATGAGGAAAGGTCATTG GTGGATGATTCATGTGTTAATTTTGAGTCATTATGCTTTGATGAGCTTTTCACTAACATC AGACAGGGTGCTAACCAAGATAATTCTACTGAAAAAGTATACAACAGAGGATTGACAATT TTCATTTTGGCGTCTGTCTTTCCTGATTTATCTGCTCAGAGGAGGAGGGAAATGCTGCAG TCCTTAATTTTTTGGGCCGATTTTACTGCGTTTGAGCCAACTTCTTCTTTCCACAATTAC CTTTGTGCATTCCAGAGTGTTATGGAGAGTTGCAAACTTCTGTTAGTTCAGACTTTGCAG TTCTTTGGTGCCATCCCACTGGAGCTGCCCACTGAGGGACAACATGAAAGTGGACTGGAG TCACATTCATGGTTCCTCAGTGATGTCTACCGCAGTTCAAGTCAAGATAAGGCCTCCGAG AAGTTAGAAGGTGACAATGTTGGTGCTGATATTGTGAATAAAAAGGTTTATCATTTATTT CCTGAGGAAATAGAGGAATTCTCAAAACACTTGGAGGTTCTTATTGGTAAGCTTTACTCG ACGACTGAGCTATGTTGGAATCTTCATCATCAACTATCTAAGAAGATGACTATTACATCA ACAGAGTGTTTTATGTACTCAAGATTCTTGGCATCAATTGCACAAAGAGTTAATGACGCT CAAGAAAATGACGCCGAAATTTCTTTCCCATCTACGTCAATTGACCAGTTCCCTGATCAT TGGAGGACTGGTTTAGAAGTGATTTCTGAGACCATTCTGACCCTTCAAGAAAACAGATGC TGGGAAGTTGCTTCTGTTGTGCTTGATTGTGTACTTGCTGTGCCCCATAAGTTTGGCTTT AATAGTGTGATTGGCTCCATCTGTTCTGCAATAAAAAGTAGTTCTTGCAATGCACCGAAA ATTGCTTGGCGCTTGCAGAGTGATAAATGGCTATTGATTTTACTTACCAAAGGTGTCCAT TCCCTCAAGGAATGTGAGGTTCCTCTTGCTAATTTGTTCTGTACAATGCTGGGTCATCCT GAACCTGAGCAACGATCTATAGCCCTTAAGCTCTTAGGAAAACTTGTTGGCCAAGATTTG AGTGGAGGAACTGCCCTTCAATCTTCCATGTTCTACAAAAATTTAGTTTCACCTGGATTT GTTACATCTGTTCCCGAGTCGATTATTTCTCATTTGGTTTCAAGTACATGGAATCTGGTG GTTGTCCTTGCTTCATCTGATGCATCATTACTTGTGAGGACTCAGGCAATGACACTTCTT GTAGATTGTATCCCATTTGCTGAGCGACGTCTGCTGCAGTCTTTTCTTGCTGCAGCTGAT AGTGTTCTTGGCTTGGGAGAGCTTGCCCGTCGAAATTGTGAGGGCCAATTGCTGAGGCTT TCATTAGCACTGATTGCTGGTGCTTGTCTATACAGCCTGGATGAAGATATCTCTCTGATT CCTCAGAATGTTTGGAAGAATATTGAGACTCTGGCATCGTCAAAGCCTGATGGAAGGTCT GGGGATGTCGAGAAAAGGGCTTGCCAAGTCTTGTGTAGATTGAAAAGTGAAGGGGATGAA GCTAAAGAGGTCCTGAGAGAAGTGCTAACTTCAAGCTCTTCAAAACAATCTGACCCAGGT TTTGAAAGTACTCGTGAGTCCGTTCTTCAGGTCCTTGCCAGTTTAACTTCTGCAAAGTCG TACTTTGATATTTTCTCAAACAAAATTGACCAAGAGGTTATGGAACTAGAGGAGGCTGAA TTAGAATGGGACATCCTTCAGAAAGAACATGCATTACATGAATCACCAACCAAAGATGGA CATCAGATTCTTTCTCTAAGCTCTCCCGTGGAAGATGTTGCACGCCTTAAGCAAATCAAG GATTGCATTCATTCCTTAGAAAAGTCCAAGCTCCATGAAGACATAGTCGCCCGCAGGCAG AAAAAACTTCTTATGAGACATGCCCGCCAGAAATGTTTTGAAGAGGCAGCTTTACGAGAA GCTGAGCTACTTCAAGAACTTGATAGGGAGAGAGCAGCTGAAGTTGAAAAGGATATCGAG AGACAGAGATTGCTAGAACTTGAGCGTGCAAAAACCAGGGAGCTGCGACAAAACCTTGAG ATGGAGAAGGAAAGACAAGCCCAGAGAGAGCTTCAGCGTGAATTGGAACAGGCTGAAGCA GGAGTACGACCATCACGACGCGACTTTTCCTCTACGTACAGCAGTCGGCCACGGGAAAGG TATCGTGAAAGAGAAAATGGAAGAGCAGGTAGTGAAGGTAGCACGAGATCAAGTTCTGGA AATTTGCAGCTTGAAACTTCTACTACCAGTTCTTCCATGGGGACAATGCCAACTGTGGTT CTGTCTGGGTCTCGGCAATTTTCTGGCCAGCCTACCATTTTACAATCTCGTGATCGTCTG GATGATGGTGGCAGTGGTTATGAAGAAAATCTGGATGGAAGCAAAGACTCAGGTGACACC GGTAGTGTTGGAGATCCGGACTCAGTTTCAGCATTTGATGGACAGCCTGGTGGATTTGGA TCAGGTCAGCGGCATGGTTCAAGAGGGAGCAAGTCCAGGCAAGTAGTGGAGCGGAGAGAA CGGGATGGGAGACGAGAAGGAAAGTGGGAAAGAAAACATTTATGA
PEP MDIEFEARVKPLEYKVKAMSRESPSQKAGHVLDADLRSHWSTATNTKEWILLELNEPCLL SHIRIYNKSVLEWEISVGLRYKPETFVKVRPRCEAPRRDMIYPMNYTPCRYVRISCLRGN PIAIFFIQLIGVSVTGLEPEFQPVVNHLLPSIISHKQDAHDMHLQLLKDMTSRLLVFLPQ LEADLNNFLDAAEPNLRFLAMLAGPFYPILNLGHERTAAKSSGNISDSEVSKHSQPSSAL TVSSNFEPRRSRGTSPFVLSTSSSIVFRADAIFVLLRKAYKDSDLGIVCRMAARVLHKLI EPVAHEGSTPPGEVTYGDEAVKSEITNPAPLVDYSNLFGEEFQLPGDHWDSSYLNILDIG AVEEGILHVLYACASQPQLCSKLADRTSDFWSALPLVQALLPALRPSVSRPSDIVDDSFS QWKQPIVQQALSQIVATSCSSLYRPLLHACAGYLSSYSPSHAKAACVLIDLCCGVLAPWL SQVIAKVDLAVELLEDLLGVIQGARHSLLRARAALKYVVLALSGHMDDMLGKYKEVKHRI LFLVEMLEPFLDPAVGRLKGIIAFGDLSSAHPEKQEENCVIALNVIRTAVQKPAVLPSLE SEWRRGSVAPSVLLSILEPHMQLPPEIDLRTSPVPRALEPESLSGLSHSSASHHGVASKS NSQDEFDGKIDVSDTAVKIDISEDASLLFAPPELHNIVLTSVSSCPNENISVSNHGDSGS EPKHLVGKHFPQRFQIDLKLDAGFSAEYFNLQADYFQLITYQDCELRASEFRRLALDLHS QNEITIESHDAAIDALLLAAECYVNPFFMMSFRGNPKLMKEINVSGIRNPQNHEIGMRMV SGKSKNDLETISLLERKRDKIVLQILLEAAELDREYREKVSDRGLSPYYTVGFDEQVIRL CPLDVQSADAITLVRQNQALLCCFLIQRLQREQHSMHEILMQCMIFLLNSATKLYCAPEH VIDIALGSAEYLNGMLTSLYYQFKENNLQLEPETIHGIQRRWILLQRLVISSSGGDEETG FAINKNGFRYGNLIPPSAWMQRISTFSRCTSPLVRFLGWMAVSRNARQYMKDQLLLASDL PQLTSLLSTFADELSVVDNVVSRKYEESGGEIVSVPIKGFEVADQQHQDQSFRVIYPDLF KFFPNMKKQFEAFGETILEAVGLQLRSLPSSMVPDILCWFSDLCSWPFLHTEQLSARNSS DLLKGYVSKNAKAIILYTLEAIVTEHMEAMVPEIPRVVQVLACLCRASYCDVSFLDSVLS LLKPIISYSLYKVSDEERSLVDDSCVNFESLCFDELFTNIRQGANQDNSTEKVYNRGLTI FILASVFPDLSAQRRREMLQSLIFWADFTAFEPTSSFHNYLCAFQSVMESCKLLLVQTLQ FFGAIPLELPTEGQHESGLESHSWFLSDVYRSSSQDKASEKLEGDNVGADIVNKKVYHLF PEEIEEFSKHLEVLIGKLYSTTELCWNLHHQLSKKMTITSTECFMYSRFLASIAQRVNDA QENDAEISFPSTSIDQFPDHWRTGLEVISETILTLQENRCWEVASVVLDCVLAVPHKFGF NSVIGSICSAIKSSSCNAPKIAWRLQSDKWLLILLTKGVHSLKECEVPLANLFCTMLGHP EPEQRSIALKLLGKLVGQDLSGGTALQSSMFYKNLVSPGFVTSVPESIISHLVSSTWNLV VVLASSDASLLVRTQAMTLLVDCIPFAERRLLQSFLAAADSVLGLGELARRNCEGQLLRL SLALIAGACLYSLDEDISLIPQNVWKNIETLASSKPDGRSGDVEKRACQVLCRLKSEGDE AKEVLREVLTSSSSKQSDPGFESTRESVLQVLASLTSAKSYFDIFSNKIDQEVMELEEAE LEWDILQKEHALHESPTKDGHQILSLSSPVEDVARLKQIKDCIHSLEKSKLHEDIVARRQ KKLLMRHARQKCFEEAALREAELLQELDRERAAEVEKDIERQRLLELERAKTRELRQNLE MEKERQAQRELQRELEQAEAGVRPSRRDFSSTYSSRPRERYRERENGRAGSEGSTRSSSG NLQLETSTTSSSMGTMPTVVLSGSRQFSGQPTILQSRDRLDDGGSGYEENLDGSKDSGDT GSVGDPDSVSAFDGQPGGFGSGQRHGSRGSKSRQVVERRERDGRREGKWERKHL


| Top |