Cherry SNP DataBase

Gene information

Gene Pav_sc0000017.1_g140.1.mk
Chromosome name PAV_r1.0chr1
start 11689710
end 11694047
PAV_r1.0 name Pav_sc0000017.1
start 67615
end 71952
direction -
Annotation NR PREDICTED: 3-phosphoshikimate 1-carboxyvinyltransferase 2
Sequence CDS ATGGCCCAAGTGAGCAAAATCTGTAGCAATGGAGCTCAAAGCACCAATCTTTTGCCCAAT GTTTCCAAACCCCAAATACCCAAATCTTCAAATTTACTCTCATTGAAGTCACAGTTTTCG GGATCCTCAAATTCTTTGAGTTTGAAGATGAAAAAAGGGTTTCTGGGTACTTGTAAGGTC GACAAAGTGAGGGTTGGTCCCCTTAGAGTTTCAGCTTCAGTTGCCACAGCAGAGAAGCCG TCGACAGTTCCAGAGATTGGAACAACTGTTGTAGACAACTTGTTAGATAGTGATGATATT CATTATATGCTTGGTGCATTGAAAACCCTTGGGCTCAATGTGGAAGAGGACAAGGCAAAC AAGCGAGCAGTTGTGGAGGGTTGCGGTGGTCAGTTTCCTTTGGGTAATGAATCAGGAGAT GAGGTGCAACTTTTCCTTGGAAATGCTGGTACAGCAATGAGGCCATTGACGGCTGCAGTT GTTGCTGCTGGTGGACATTCGAGGTATGTGCTTGATGGGGTGCCCCGAATGAGGGAGAGG CCAATTGGAGATTTGGTTGCTGGTCTTAAGCAGCTTGGTGCAAATGTTGATTGTTTTCTT GGAACAAACTGCCCTCCTGTCCGTGTAATTGGAAAGGGAGGCCTTCCAGGGGGAAAGGTG AAGCTCTCTGGATCAATTAGCAGTCAATACTTGACTGCTTTGCTTATGGCAGCGCCTTTG GCTCTTGGAGATGTTGAAGTTGAGATCATTGATAAACTGATTTCCATTCCTTATGTGGAG ATGACTTTGAAGTTGATGGAACGATTTGGAGTCACAGTGGAACACAGTGATAGCTGGGAT CGGTTTTGGATCCGAGGAGGTCAAAAGTACAAGACACCTGGAAATGCTTTTGTAGAAGGT GATGCTTCAAGTGCTAGTTACTTTCTAGCAGGTGCTGCAGTCACGGGTGGGACAGTCACA GGAGATGTAAAATTTGCTGAGGTTCTTGAAAAGATGGGTGCTAAAGTTACCTGGAGAGAG AATAGCGTCACTGTTACAGGACCACAACGAAATTCTTCCAGAAAACACTTGAAAGCTGTT GATGTCAACATGAACAAAATGCCAGATGTTGCGATGACTCTTGCTGTTGTTGCTCTTTTT GCCGATGGTCCAACTGCCATAAGAGATGTGGCAAGCTGGAGAGTGAAGGAGACAGAAAGG ATGATTGCCATTTGCACTGAACTCAGAAAGCTGGGAGCAACTGTCGAAGAAGGACCAGAT TACTGTGTAATCACACCGCCAGAAAGATTAAATGTGACAGCAATTGACACCTATGATGAC CACAGAATGGCCATGGCTTTCTCTCTTGCTGCATGTGGAGACGTTCCAGTCACTATCAAT GATCCGGGTTGTACCAGAAAAACATTCCCTGATTACTTTGAAGTCCTTGGGAAGTTTACC AAGCATTGA
PEP MAQVSKICSNGAQSTNLLPNVSKPQIPKSSNLLSLKSQFSGSSNSLSLKMKKGFLGTCKV DKVRVGPLRVSASVATAEKPSTVPEIGTTVVDNLLDSDDIHYMLGALKTLGLNVEEDKAN KRAVVEGCGGQFPLGNESGDEVQLFLGNAGTAMRPLTAAVVAAGGHSRYVLDGVPRMRER PIGDLVAGLKQLGANVDCFLGTNCPPVRVIGKGGLPGGKVKLSGSISSQYLTALLMAAPL ALGDVEVEIIDKLISIPYVEMTLKLMERFGVTVEHSDSWDRFWIRGGQKYKTPGNAFVEG DASSASYFLAGAAVTGGTVTGDVKFAEVLEKMGAKVTWRENSVTVTGPQRNSSRKHLKAV DVNMNKMPDVAMTLAVVALFADGPTAIRDVASWRVKETERMIAICTELRKLGATVEEGPD YCVITPPERLNVTAIDTYDDHRMAMAFSLAACGDVPVTINDPGCTRKTFPDYFEVLGKFT KH


| Top |