Cherry SNP DataBase

Gene information

Gene Pav_sc0000017.1_g450.1.mk
Chromosome name PAV_r1.0chr1
start 11842381
end 11854127
PAV_r1.0 name Pav_sc0000017.1
start 220286
end 232032
direction +
Annotation NR PREDICTED: DNA topoisomerase 3-beta-1 isoform X1
Sequence CDS ATGTTGGCTATTGACCTTGGTGTAAAGGCTCATATTCGCAGGCATCTAAGCCAAGAAGCT CGTGGTTATGGTAACTTGGTTTTATGGTTGGATTGTGATCGCGAAGGGGAAAATATTTGT TTTGAAGTTATGGATTGTATTGGCAATTCAAATGAGACTAGAAGAAGGATTTATCGTGCT CGGTTTTCCTCTGTTACTGAGAAAGACATTTTAAAGGCCATGGACAACCTTGTTGAACCT AATAAAGATGAGGCATTGGCAGTAGATGCTCGGCAAGAGATAGATTTGAAAATAAATACA TTCAAACCGGAAAAGTTTTGGGCTGTACGCCCTTACATAATGCAAAAGGGCTACGAACTT CAGCTAGAATGGGAACGTAACAAGTTGTTTGACTACGATGTTGCTGTAATGTTTCAAAAG TTAGTAATGGAAGATGGAATTCTAGAAGTGACTGAGATAGTAGAAAAGCAAGAAAGCAAA AGTCGTCCTTCTGGTCTTAATACAGTCAATCTTCTGAAGGTTGCTTCAAGTGCACTAGGC TTTGGACCACAAATGGCTATGCAAGTTGCTGAACGCTTGTATACTCAAGGTTTCATCAGC TATCCGCGTACCGAGAGCACAGCTTATCCTTCTTCTTTTGACTTTAGAGGCACACTTGGT GCGCAAGTAAATAACCCAACATGGGGTAGTTATGTTCAGAGGCTGCTTGCTGATGGTTAT CAAAAGCCACGATCCGGGACAGATGTAGGTGACCATCCTCCTGTTACTCCATTGAGGTCT GCAACTGAGGACATGCTAGGAAATGATGCTTGGAGACTATACGAGTACATTTGTACACAC TTCATAGGGACTGTATCTCCTGACTGCAAATATGTAAGAACAAAGGTAGAATTTTCGATC GGTGGAGAATTCTTCCATTGTGTAGGGCATCGTGTTTTGGTGAAAGGATTTACTTCTATC ATGCCATGGTTGGCGGTAACTGAGAAAAATCTTCCTCAGTTTACAAAAGGGGAGAAAATA GAAGTTTCACAAGTGGACCTTCATGAGGGGATGACATCACCTACAGACTATCTAAGCGAG AGTGAGCTAATTTCCCTTATGGAGAAAAATGGAATTGGCACAGATGCGTCAATATCTGTT CATATTAACAACATATGTGAGCGCAATTATGTGCAGGTACTAGCTGGCAGGAAGCTGGGT CCAACTGCCTTAGGTATTACTCTAATAAGAGGCTATCAATGCATCGATCCAGATCTCTGT TTGCCAGATATTCGCAGTTTCATCGAGCAGCAAATTACTCTTGTTGCTAAGGGGCAAGCA GATCATTTTCGTGTTGTGCAGCATGTCCTACAACAATTCAGGCAAAAATACAGTTACTTT GTCAAGCAGATTGAAAACATGGATGCATTATTTGAAGCACAATTCTCTCCCCTTGCTGAC TCAGGACGAGTTCTCAGTAAATGTGGCAAATGTCTACGGTACATGAAGCACATTTCCACC CAACCTTCACGTTTGTATTGTAATACATGCGAGGAGGTTTATTATCTTCCTCAAAAGGGT AGCATTAAGCTCTACAAGGAACTTACTTGTCCTCTTGACAACTTTGAGCTACTAATCTTC TCCATGCCTGGCCCGGATGGCAAGTCATTTCCTCTCTGCCCATACTGCTACAATAGTCCT CCTTTTGAAGGTATCGACACGCTCTTTGGTGCTGTAAAATCTGGTCCATCAAGCCAGCTG GGAAAGGGAGCTGGGATGCCATGCTTCCTATGCCCACACCCCACATGTCGACATTCTTTG ATTGCCCAAGGAGTCTGTGCTTGCCCAGAATGTAGTGGAACACTTGTTCTAGACCCTGTG AGTGCTCCCAAATGGCGGCTCTGTTGCAATATGTGCAATTTCCTTGTCTTGCTTCCTGAA GGAGCTCACCAGATTTCCACTACTCGAGAGCGGTGCCCTGAGTGTGACTCCACGATCTTA GAAGTGGACTTCAATAAGAAGACAACACCCTTGGAGAATGGAGAGACGTTGTATACAGGT TGCATTCTTTGTGACGAATTGCTCCATTCGCTAGTGGAGATGAAATATGGCAGATCATTT TTCAAGCGCATGGGTGGAAGAGGTAGGGGTAGAGGATCAAGGAGAGGTGGATATAGGGGA AGAGGGCGGGGTACCGGGAAGAAGGTGGATCCTAAAATGAGCTTCCGTGATTTCTGA
PEP MLAIDLGVKAHIRRHLSQEARGYGNLVLWLDCDREGENICFEVMDCIGNSNETRRRIYRA RFSSVTEKDILKAMDNLVEPNKDEALAVDARQEIDLKINTFKPEKFWAVRPYIMQKGYEL QLEWERNKLFDYDVAVMFQKLVMEDGILEVTEIVEKQESKSRPSGLNTVNLLKVASSALG FGPQMAMQVAERLYTQGFISYPRTESTAYPSSFDFRGTLGAQVNNPTWGSYVQRLLADGY QKPRSGTDVGDHPPVTPLRSATEDMLGNDAWRLYEYICTHFIGTVSPDCKYVRTKVEFSI GGEFFHCVGHRVLVKGFTSIMPWLAVTEKNLPQFTKGEKIEVSQVDLHEGMTSPTDYLSE SELISLMEKNGIGTDASISVHINNICERNYVQVLAGRKLGPTALGITLIRGYQCIDPDLC LPDIRSFIEQQITLVAKGQADHFRVVQHVLQQFRQKYSYFVKQIENMDALFEAQFSPLAD SGRVLSKCGKCLRYMKHISTQPSRLYCNTCEEVYYLPQKGSIKLYKELTCPLDNFELLIF SMPGPDGKSFPLCPYCYNSPPFEGIDTLFGAVKSGPSSQLGKGAGMPCFLCPHPTCRHSL IAQGVCACPECSGTLVLDPVSAPKWRLCCNMCNFLVLLPEGAHQISTTRERCPECDSTIL EVDFNKKTTPLENGETLYTGCILCDELLHSLVEMKYGRSFFKRMGGRGRGRGSRRGGYRG RGRGTGKKVDPKMSFRDF


| Top |