Cherry SNP DataBase

Gene information

Gene Pav_sc0000017.1_g720.1.mk
Chromosome name PAV_r1.0chr1
start 12089175
end 12093713
PAV_r1.0 name Pav_sc0000017.1
start 467080
end 471618
direction +
Annotation NR PREDICTED: TATA box-binding protein-associated factor RNA polymerase I subunit B
Sequence CDS ATGTCGAATTCGTGGATTTGTGAAACTTGTGGCAACGAGGAGCTGGTAGACGGCAATAAT GGCTTCTTCTACTGCAGCCAGTGCAACTCACAAGCGCAGGGCTTCAAGGACACCGGGGTG GCCGATGAGGACTTTTACGACGAGACTGGCGATGCACAGGGAGGCCTCTACTCTGCCCGT AACACCCGCCGCGTCAACATCTCCGCCGTCAAACCCGAGGCCCTTTCCCAACCCCTGGAT AATAACCCTTTGAGTCAAACCAACATGGAAAATGACAATGCTGATGCTGTGGGACCCACG GAACCCGAGGATTTTGGATTCGACACGGTGGAGGGCTATTACAGTGAGGTTAGGCTTAGG TATGTGAAAGGAGTGCAGCGGATGATTGAGCTCCAATGTGAGGCTTTGGTTAGGGAGTTT AAGGTGAACCCTTTGATTTGTGGGTTGTCTGGGTCCATTTGGCTACGCTTATTGGCTTGG ACTCGTGTTTTTCAGGATGATTGGGGTGACCGGACTTTCGATGACGCTGAGATACGCCAA CAAGGGGAACCACCCGAAGATTTTAAGCCACGCTCTAAATACAGAGACGAACCTCACACA AGGGAAGCAGTCCTACCGACAGACATAGTAAAATGGTCAGTTGAAGGAAAGCTCCCATAT TTTTCTGCTTTTCTTGAAATTGAAAAAGACTTGGGAAGGCCTTCACGTGCCTGCCCAATA AGTTCAAGCTTAATGTTTAGACCTTCTGAATCTGTGCCAGTGCAAAAGTTGGAAGCACTG GCAGCATCCATTGCTGAGTCCATAGGCTTGCACTTACCTCCAGTGAATTTTTTTGCTATA GCTTCTCGCTATCTGAAAAAGTTATCTCTTCCAGTCGGAAAGGTTCTCCCTCACGCATGT CGCATATATGAGTGGTCAATGCCTCCAGATTTATGGTTATCAACAAATGAGTTGAGGCTT CCTACTCGTGTGTTTGTTATGTCAATACTGATTGTAGCAGTAAGAATTCTTTATAATATT CATGGTTTTGGAGAATGGGAAAAAAGTTTGTCCAGAATTCATACTTTGTCTTCCACATCT AATCAGATGGGAGATCTGGATCCCACATCCAATTCCAAAATGCGGTCTGGTACTGCAGAG GATTTAGGTTCGCCATCCCACAATTTGGATGATACGGATACAGAGCTTGTTAGAAATTTG TCAAATGCTCAGAACTCTGAATTGGACGCTGCAGAACTTCTATCCAGCCTTGAAGCAAAG CATAATGAAATTGCTGATACTTATGAATATTGCAAGGACTTACCAACGTATCTTCAGTTC TGCAAGGATGTAGTCTTTGCTGGATCAAAATCATCATTCAAGGATCACAAGGAAGAAGAG CTAATTGAATTGTTATGGAACTTTTATCAGAGTAGAAAGGATTCTGAAACAGCAGTCGAA CAAGGATTGCTTTGTGGTGAAACTGTTAACCAGAAAAGATTGAGGGACAATGAAGAGTGC ACTAATGATATATCTGAAGAAAAAAAGTTTAGTAATAAATGCCCTGTTTCTAGCCCTTAC TCTGGTGATGAAACTCCCTTCGCGGACGACCAACAAAGGAGCAAAAATGGCGATAATTCT TGTAGTAGCTCACAGAATAGTCAGAACTCAGAAGTTAATGACGCAGAAACTCTCAAAGAG GAAGCCATTACTCGAATGAAATTAGACATGGAGGAGAAGAGATTCTTTTATATTCCACCG AGGGTCAACCTCAAAAGATTTGATTACCTTCACTATGTAAGGAAGAAGGATGAAGGTGCC TACACTTATGCTGCACATGCTGATTATTACATCTTGCTTCGTGCTTGCGCTAGAGTTGCA GAAGTTGAAATCCGGTGTATGCACATTGCAGTGTTGAGCTTCGAGAGGAGGCTGGCTTGG ATGGAAAAGAGAATCAACCACTGCTTGCACTTGACCCCACCTATTGTCTCATGCGAGTAT TGTGCTGATATGGTCCCAGAAAATACTAATGCAGAAAATGATATTGAATCGATTGGTTTT CCAGATTTGAATTTATGA
PEP MSNSWICETCGNEELVDGNNGFFYCSQCNSQAQGFKDTGVADEDFYDETGDAQGGLYSAR NTRRVNISAVKPEALSQPLDNNPLSQTNMENDNADAVGPTEPEDFGFDTVEGYYSEVRLR YVKGVQRMIELQCEALVREFKVNPLICGLSGSIWLRLLAWTRVFQDDWGDRTFDDAEIRQ QGEPPEDFKPRSKYRDEPHTREAVLPTDIVKWSVEGKLPYFSAFLEIEKDLGRPSRACPI SSSLMFRPSESVPVQKLEALAASIAESIGLHLPPVNFFAIASRYLKKLSLPVGKVLPHAC RIYEWSMPPDLWLSTNELRLPTRVFVMSILIVAVRILYNIHGFGEWEKSLSRIHTLSSTS NQMGDLDPTSNSKMRSGTAEDLGSPSHNLDDTDTELVRNLSNAQNSELDAAELLSSLEAK HNEIADTYEYCKDLPTYLQFCKDVVFAGSKSSFKDHKEEELIELLWNFYQSRKDSETAVE QGLLCGETVNQKRLRDNEECTNDISEEKKFSNKCPVSSPYSGDETPFADDQQRSKNGDNS CSSSQNSQNSEVNDAETLKEEAITRMKLDMEEKRFFYIPPRVNLKRFDYLHYVRKKDEGA YTYAAHADYYILLRACARVAEVEIRCMHIAVLSFERRLAWMEKRINHCLHLTPPIVSCEY CADMVPENTNAENDIESIGFPDLNL


| Top |