Cherry SNP DataBase

Gene information

Gene Pav_sc0000024.1_g040.1.mk
Chromosome name PAV_r1.0chr4
start 24370711
end 24380641
PAV_r1.0 name Pav_sc0000024.1
start 8167
end 18097
direction +
Annotation NR PREDICTED: crt homolog 1
Sequence CDS ATGATGTCGTGTATCCGCCGGGTATGGGCCGGCGCCGGAGCTCCGGACCGACCTATTAGG ATCCGGGAACATCCGCGAGCTTGGGAGATCCCGCGTCTCCCCCGCAGATTCCGCGGGAAT CAACGGCCAGAAATCGTCCTCCGGACTACACCGTCTAAGCATTTGCGGCCGGTGGTGTGG GCGGTGGAAGCGGCGGGACCAGGAGGAGCGTGGGATCGATTGGACGGGGGAGATGGAACG GAGAGCTCGAAGGCGGGGCCGTGCTCGTACGCGGTGGGGGAGTATCGGACGGTGGAGCAG GAAGGAGAGAGGAGTCAGGATCGGAGGGTGGACGTGGCGGTTGCAGCGGCGGTTACGGTG GTTCTGGGTGTAGGCAATCGGGTGCTCTATAAGCTGGCCTTGGTTCCTCTCAAGCACTAC CCTTTCTTTCTCGCTCAGCTCGCCACTTTCGGATATGTAATTGTATATTTCTCAGTCTTG TATCTCCGGTACCGTGCTGGTATTGTCACAGATGAGATGCTTTCCATGCCAAAAGCTCCA TTTCTTGCTGTTGGCCTCTTGGAAGCTCTTGGTGCTGCTACTGGAATGGCAGCTGGAGCA ATTCTTTCTGGAGCATCAATTCCAGTTTTGTCTCAGACGTTTCTTGTTTGGCAAATTCTC CTGTCAATTATTTTCCTTGGAAGGAGATATAAGGTCAATCAACTTTTGGGGTGCTGTTTT GTAGCCATTGGTGTAATCATAACTGTAGCGAGTGGATCTAGTGCTGGACATTCATTAAAA GAAGCTGGTATATTTTGGAGTCTTCTCATGATAGTTTCATTTTTGTTCCAAGCAGCTGAT ACAGTGCTGAAGGAAGTAATTTTTCTGGATGCTCGTCAGCAATTAAAGGGAAGTTCGGTG GACCTATTTGTTGTAAATTCCTTTGGGTCTGCTTTTCAAGCAATATTTATATGCCTTCTC TTACCTTTTTTGTCCAAATTATGGGGTATTCCATTTGGTCAACTGCCAAACTATCTCAAA GACGGTGCAGCTTGCTTTCTAAATGTGGGTACCTTATCAAATGGATGCGATGGTGCCCCC TTACTTCCTTTGCTGTTTGTTGTTGTCAACATGGGTTTTAACATATCATTGCTGCATCTT CTCAAGATATCTTCTGCGGTGGTATCTTCCCTCGCATCAACATTTTCAGTGCCAATATCT GTATACGTCTTCACATTGCCGCTACCGTACCTAGGTGTTGCAGCCTCGTTGCCGACAGGC TTTGTTTCTGGAACCATTATTCTTGTAATTGGCTTGCTCATCTATGCCTGGACACCTTCA GTCTATCCAACTAGTGCCTCCCCATCACCTCCTAATGTATGA
PEP MMSCIRRVWAGAGAPDRPIRIREHPRAWEIPRLPRRFRGNQRPEIVLRTTPSKHLRPVVW AVEAAGPGGAWDRLDGGDGTESSKAGPCSYAVGEYRTVEQEGERSQDRRVDVAVAAAVTV VLGVGNRVLYKLALVPLKHYPFFLAQLATFGYVIVYFSVLYLRYRAGIVTDEMLSMPKAP FLAVGLLEALGAATGMAAGAILSGASIPVLSQTFLVWQILLSIIFLGRRYKVNQLLGCCF VAIGVIITVASGSSAGHSLKEAGIFWSLLMIVSFLFQAADTVLKEVIFLDARQQLKGSSV DLFVVNSFGSAFQAIFICLLLPFLSKLWGIPFGQLPNYLKDGAACFLNVGTLSNGCDGAP LLPLLFVVVNMGFNISLLHLLKISSAVVSSLASTFSVPISVYVFTLPLPYLGVAASLPTG FVSGTIILVIGLLIYAWTPSVYPTSASPSPPNV


| Top |