Cherry SNP DataBase

Gene information

Gene Pav_sc0000026.1_g110.1.mk
Chromosome name PAV_r1.0chr2
start 12993042
end 12999016
PAV_r1.0 name Pav_sc0000026.1
start 58153
end 64127
direction -
Annotation NR PREDICTED: F-box protein At5g51370-like
Sequence CDS ATGTCATATTCACCAGACAGAAAATCTGGAAGCCCAACAAAGTCACAAGTTCTGAAGAGG CCAAGGCCATTGAGCCTCCCAGACCAAGCTCTCAAGTATGTTATCATGAAGATGCAGCTT CAGAGCCACCACCACCACCACAGCTCTCTCTCTCCTTCAACTGCTTCACCTTCTCCTCAC TCTGAGTCTGACCTCTCTTCTGGGTTCAATTCCCTTACCCTAGACCCTCCCGCACCAGAT TCCACCTCCCTCTTATCCGATGAGCTTCTCCTCTCCATCTTCTCCAAGCTCCCAATTTCC CAGTACCTCCCCAACTCCCTTGTCTGCAAGCGCTGGCTGTACCTCCATGGCCGCTTGGTG CAATCTGTAAAGGTCTTTGATTGGGGATTTTTGGACTCCGGTCGGGTCTTCGCCCGGTTC CCGAACCTCACTGAGTTTGATATCGTCCATGCTTGCATTCGGTCGCCGCGGAATTCGGGG ATTCTTGTGACGAGGAAGGCTTTGACTGTTCATATCGACTCGCTTTTCAGCCCAAATGGG TTTATTGAGGAAAGTGATGTGTTGAAGAACAGTGTGGTGGATGATGGGCTCGGGTTGATT GCCAGTTCGTACCCGAATTTGCGCCGAATTGCGGTTATAGGTGCCAGTGAAAATGGGTTG TTGAGGATTGCTGAGGATTGTCAAACACTGCAGGAATTGGAGCTGCATTGTTGTGGAGAC TTGGCGTTGAAGGGAATTAGTACGTGTAGGAACTTGCAGATTGTGAAATTGATTGCTTGC GTTGATGGGTTTTACAGGGCAGTGATTTCGGATATTGGGTTGACAATTTTAGCTCAGGGG TGTAGGAGGTTAGTGAAGCTTGAGCTTTGTGGGTGTGAAGGGAGCTATGATGGGATTAAG GCAATTGGGCAGTGTTGCCAAATGCTTGAGGAGTTGACTCTCAATGATCATAGGATGGAT GGTGGGTGGTTGGCTGCTCTGCCCTTTTGTGGGAATTTGAAGACTTTGACGCTTGAGTCT TGCAAGGACATTGATTCAAACCCCGGCCCTGATGAGCACTTGGGATTTTGTCCCACCATT GAGGAGTTGCATTTGCGGCGGTGTCAAGTGAGGGATAAGCATGGTGTGAGAGCATTGTTC TTGGTGTGTGAGGCTGTTAGGGATATTGTTCTGCAGGATTGTTGGGGGTTGGTGGATGAA GTATTTGCATTTGCGAGTATTTGTAGGAGGGTGAAGCTGATTTCTCTGCAAGGATGCTCA CTGCTGACAACAGGAGGTCTGGAGTCGGTGCTCCTTTGTTGGAAAGAGCTTCAAAGGCTT AGAGTAGTATCATGTAAAAATATAACAGACAGTGAAACAACTCCTGCCTTGGCAACCTTA TTTTCTGTTCTGATAGAGTTGACATGGCGACCAAATACCAGATCTCTCTTGTCATCAAGT CTTGCTGGGACTGGAGTGAGACTGAAAGGTGGCAGGTTTTTCAAGAGTTTAAAGCCTTAA
PEP MSYSPDRKSGSPTKSQVLKRPRPLSLPDQALKYVIMKMQLQSHHHHHSSLSPSTASPSPH SESDLSSGFNSLTLDPPAPDSTSLLSDELLLSIFSKLPISQYLPNSLVCKRWLYLHGRLV QSVKVFDWGFLDSGRVFARFPNLTEFDIVHACIRSPRNSGILVTRKALTVHIDSLFSPNG FIEESDVLKNSVVDDGLGLIASSYPNLRRIAVIGASENGLLRIAEDCQTLQELELHCCGD LALKGISTCRNLQIVKLIACVDGFYRAVISDIGLTILAQGCRRLVKLELCGCEGSYDGIK AIGQCCQMLEELTLNDHRMDGGWLAALPFCGNLKTLTLESCKDIDSNPGPDEHLGFCPTI EELHLRRCQVRDKHGVRALFLVCEAVRDIVLQDCWGLVDEVFAFASICRRVKLISLQGCS LLTTGGLESVLLCWKELQRLRVVSCKNITDSETTPALATLFSVLIELTWRPNTRSLLSSS LAGTGVRLKGGRFFKSLKP


| Top |