Cherry SNP DataBase

Gene information

Gene Pav_sc0000028.1_g050.1.mk
Chromosome name PAV_r1.0chr1
start 7347220
end 7348867
PAV_r1.0 name Pav_sc0000028.1
start 24480
end 26127
direction +
Annotation NR PREDICTED: probable enoyl-CoA hydratase, mitochondrial isoform X1
Sequence CDS ATGGCCAGCCACCAATCCTCGCCGGAAAATCTCATACTCGTAAACCGCGAACCCAGCGGA ATCGCATTCGTGACGATCAACCGTCCCAAGTCGCTTAACTCGCTGACCCGGCCCATGATT ATAGACCTCGCCAAGGCCTTCAAGGCCCTCAGTCAAGACGAGTCGGTCCGAGTCATCATT CTATCCGGGTCGGGTCGCGCCTTTTGCTCCGGAGTCGATCTCACGGCCGCGGAGGACGTT TTCAAAGGGGACGTGAAGGACATGGAGACCGACACGGTGGCGCAAATGGAGCGGTGCCGA AAGCCCATCATCGGAGCCATTAATGGGTTCGCGGTCACTGCCGGGTTCGAAATCGCGCTC GCTTGTGATATAATCGTCGCCGCAAAAGGAGCTAAATTCGTGGACACTCATGCCAGGTTT GGGATATTTCCTTCATGGGGTTTGTCTCAGAAGCTTTCGAGGATTATAGGGGCCAACAAA GCGCGGGAAGTGTCGCTGACAGCGACGCCTTTGACGGCGGAGCTGGGTGAAAGGTTGGGG TTCGTGAACCATGTTGTTGAAGAGGGTGAGTTGCTGAAGAAAGCTCGTGAAGTAGCTGAG GCCATTGCGAAAAATAACCAGGACCTGGTGTTGAGGTACAAGGCTGTTATTAATGACGGG CTTAAACTGGACCTGGGCCATGCTCTTGCACTAGAAAAGGAGAGGGGTCATGACTATTAC AGTGGAATGACCAAAGAGCAGTTTAAGAAGATGCAAGAGTTTATAACAGGTCGGGGTTCC AAAAAGCCTTCTTCCAAGTTGTAG
PEP MASHQSSPENLILVNREPSGIAFVTINRPKSLNSLTRPMIIDLAKAFKALSQDESVRVII LSGSGRAFCSGVDLTAAEDVFKGDVKDMETDTVAQMERCRKPIIGAINGFAVTAGFEIAL ACDIIVAAKGAKFVDTHARFGIFPSWGLSQKLSRIIGANKAREVSLTATPLTAELGERLG FVNHVVEEGELLKKAREVAEAIAKNNQDLVLRYKAVINDGLKLDLGHALALEKERGHDYY SGMTKEQFKKMQEFITGRGSKKPSSKL


| Top |