Cherry SNP DataBase

Gene information

Gene Pav_sc0000028.1_g930.1.mk
Chromosome name PAV_r1.0chr1
start 6792537
end 6800040
PAV_r1.0 name Pav_sc0000028.1
start 573307
end 580810
direction +
Annotation NR PREDICTED: probable inactive serine/threonine-protein kinase lvsG
Sequence CDS ATGAGAAACTATTTGGGTTTTTGCCTTTTTCTTTTCAGTAATGAATATATAGGTGATAAT TATGAAGGCTGCAGTGATAGTGTGATTGCTAATACGATCACTTCCTCTGAAGTGACTCGA GATGAAGAGGAAGTTAGTTCTGATGTTAACAATGACCAAAAACCAAAGTTGGATTCTTTA TTGAACATGTCTCCGTGTTTATCAAATGGTGGCACGAAAACATTTCTACAGAGTTCTGCC TGTAACCATTCCAGTAGGTTTTCTTGCTCGAGGGTGATCAGCGGGTTGGCGCCGATTACT CACGTTGGCATTTGTTCAGACTCCATTTTCGAAGAGCTTGCTTCGGAATTTTTGTCCAGG TCTCTGGAAGATCACATTTTGAACTCACTTAGTCTCTTGATTGAAGGGAAAGCTTCAGGA AGAGACAGTGTAAATTTTCTTAACTTACTTGGGGTACCGTCGTTTGATGAGAATCAGTTC CCTGGCTCATTGAGGCATCCAAATATTGCTCCCGTACTTGGGATGGTTAGGGCATCCAAT TATATTGATATAGTTCTTCCCAAAACTCCACATACCTTGGAAAACATTATGCATTATAGT CCCGATGCCTTAAAGTCTGATTGGCATATAAGGTTTCTAATATACCAGTTACTCTCTGCT CTAGCTTATATTCATGGTTTAGGGGTTTCCCATGGCAATATATGTCCATCCAGTGTGATG CTTACCGAATCATGCTGGTCTTGGCTGTGTATTTGTGATAAGCCTGGGGTAGGATTTACT CCAAGTTCTAGAGGTAATAGATGCACAACTATTATACCTGAAAAGGTAGGTTGCTCTATA GCTGGTTGTCCTTCTCAAGGTCTTTATGCTGATTTGAAGCTTTCCCCATCTATAGACTGG CATCGTGACTTTAAACAATGGTGGAGGGGAGAGATTAGTAATTTTGAGTATCTGCTCATC TTGAATAGATTAGCTGGGCGAAGGTGGGGTGACCACACATTTCATACAGTGATGCCATGG GTAATAGATTTTAGCATGAAGCCTGATGAGAATTCAGATGCAGGGTGGCGGGATCTAAAC AAGAGTAAATGGAGGTTGGCTAAAGGTGATGAACAGTTGGACTTCACCTATTCAACGTCA GAGTTCCCACATCATGTATCTGATGAATGTCTTTCTGAATTGGCTGTCTGCAGTTATAAA GCAAGGAGGTTACCTTTGAGTGTCCTACGTATGGCTGTTCGCTCGGTCTATGAACCTAAT GAATATCCTTCTACCATGCAAAGACTCTATCAATGGACCCCTGATGAGTGCATTCCAGAG TTTTACTGCGATCCCCAAATTTTTCATTCACTTCATGCTGGTATGACTGACTTGGCTGTA CCTTCATGGGCATGTGGTCCTGAGGAATTCATTAAATTGCATCGTGATGCTTTAGAAAGC GATCGGGTTTCACGCCAACTCCATCATTGGATTGATATCACCTTTGGTTACAAGATGGTA GGTCAGGCAGCTGTTGCTGCAAAGAATGTAATGCTTCCTTCATCAGAGCCCATGATGCCA AGGTCAACGGGACGCCGTCAGCTTTTTACTCAACCTCACCCTATGCGTCGAGGTGCAATA CCGAAACCATGTGATAGCACCAACGGGTCAGCTTTGTATCAAGGGAAAATGAATGAATTA AGTAGTGACTGTTCTGTCCTGTTTGAAACTTCTTACTTGCAAGAATTAGAAGATGCATCT GCCTTTTGTGAACATGCTATGCATTTGAGTGCCCTCTATGGCTACCATCTAGACTCCGTG AAGGACATTGCTCCTGTAGAAGAGTCATCAGGCGAGTATGTTAAGAAAAGTGTAACTCTA TCTGACACTAAGAAAAACCAGTGGTTGCGACATATTGATACAAATTATCTTCTTGAGCAT GTTGAGGTGTTGGATGAAGGTTCCAGTGGATATCAAGAGCTATTGCTTTGGAGACAGAAA TCATCATGTTCAAAGACGTTTTCTGAAGAAATTGCAAGGGACATATTTTCTGTTGGTTGT CTCTTAGCAGAACTTCATTTGAGGAAGCCACTTTTTGATCCAACCTCATTGGCCGTGTAC TTGAACAGTGGTTTATTACCTGGACTGATACATGAACTTCCTCCTCACACCAGATTACTT GTCGAAGCCTGCATTCAAAAGGATTGCATGAGGAGACCATCGGCTAAGTGTCTTTTGGAA TCACCTTATTTTCCTACCACAGTCAAGGCATCCTACTTGTTTCTTGCTCCCCTCCAGCTT CTGGCTAAAGGTGGATCTCGCCTTCATTATGCTGCGAATTTTGCAAAGCAAGGAGTCCTG AAGGCAATGGGAACATTTGCTGCTGAAATGTGTGCTCCTTATTGCTTATCGCTTGTGGTG ACTCCTTTATCAGATACTGAAGCTGAATGGGCCTATACATTACTGAAAGAATTTATCAAA AATTTGACACCTAAAGCAGTGAAACGAATAGTCTTGCCTGCCATCCAGAGGATTTTACAG GCAAGTTATTCACACCTAAAGGTTTCTATTCTACAAGACTCTTTTGTTCAAGAGATATGG AATCAAACTGGCAAACAAGCATATCTAGAAACTGTACATCCTCTTGTGATTTTGAACTTG TATGCTGCTGCTCATAAGAGTTCAGCAGCTGCCGCTTCCGTGCTGCTGATTGTCTCAAGT GAAGAGCTTGGTCTCAGTAGTGATGGAATTGACGTGCTGGTTCGAATTGGTGGTCTATTG GGAGAGAGCTTCATCGTCAGACAGATGCTACCATTGCTAAAACATGTATTTCATTCCTGC ATTGACATTTCACGTATGAATAAACCTGAGCCTGTCCACAGCTGGAGTGCTTTCGCTCTT ATTGATTGTTTAATGACAATAGATGGCCTAGTTGCATTCTTGCCAAGGGAGGTGGTTGCA AAGGAGCTAATTGAAGATAAAAGTTGCCTGCATGTTCTGGTTCTTATGCAGACAAGTTTA GAATATAGAGTGCTTCAGGTTGCTGCTACAACCCTAATGGCATTTTGTCAGCGGATAGGA CCGGATTTGACAGCATTGCATGTTTTGCCACAACTTAAAGAGCTATTTGATGAGCTTGCT TTCTCACCAAAAACTGCCAATGCTTCTACTTCCTTTGGCAGAAGGTTGAAGGGTTCAAAG CCAAAAATTGATGGGGCTCTGATTGAAAGTCGTATGGACCTTGTGTTGCTTCTGTATCCT TCTTTTGCATCCCTTCTTGGCATAGAGAAGCTTCGTCAGTGTTGTGCAACATGGTTATTA CTTGAGCAATATCTCCTACAGTATCATAACTGGAAGTGGGAACACACAGGAGAATTGTCT CGAAGTGGTTCAGACACTATACTCAGTAAAAGAAATGCATTCAGAAAGGGCTCAACTTCT GAATACAGTCCTGCTAAGCTGTTGCTCAATGGGGTTGGATGGTCAATTCCTCAATCACAA GGGTCTAGAAGTGCCAAAAACTTGATGCCTCAAAAACGGTTCTTTGAAATGCATCAGAGT CCAGCTGAAATGCATGCAGCAACATCAAATTTTAAATTGGAGCCCTGGTTTTGGTTCCCT AGTCCAGCTGCTAGCTGGGACGGGCCTGATTTTCTTGGGCGTGCTGGGGGTGTGAAGGAT GAACATCCATGGAAGATCAGAGCATCTGTCATATACTCAGTCCGTGCTCATCCTGGGGCC TTACGGTATTTAGCCGTCTGTCCAGATGAATGTACGGTTTTTACTGCCGGGATTGGTGCA GGGTTCAAAGGAACTGTTCAGAAATGGGAGCTGACTAGAATTAATTGTGTATCGGGATAC TATGGCCATGAGGAGGTTGTGAATGATATTTGTGTCTTGTCGTCTAGTGGAAGAGTTGCG TCTTGTGATGGGACAATACATGTTTGGAATAGCCGAACTGGGAAATTAATTTCAGTATAT TCTGAACCATCTGTGGATTCTGCACATAGTGCAAGCTCTCCATCTTCTTCCTCCAGGGTC AATTTGGACCAGGTCAATATGCTCAGTTCCAATACACTGTCCGGTGGAATATTGACCGGC GCATTTGATGGTAGCTTGTATACTTGTATGCATCAGACAGAATTTGGTGAAAAGCTTGTA GTTGGCACTGGAAATGGTTCTCTCAGGTTCATTGATGTTGTCCGAGGACAAAAGCTTCAC CTTTGGAGGGGGGATTCTACGGAGTCTGGTTATCCTTCCCTTGTTTCTACCATATGCTCC TGTGGGTCTGACAAAATGCAACCAGATGGAGCTTCTTCCCCATCTTGGATTGCAGCTGGA TTGAGTTCTGGTCATTGTAGGTTATTTGATGCAAGGAGTGGCAATGTTATTGCCTCTTGG AAGGCTCATGATGGATACGTGACAAAGTTGGCTGCACCAGAGGACCATTTACTTGTGTCC AGCTCTCTTGACAGGACTTTAAGAATTTGGGACTTGAGAGGGAATTGGCCATCTCAGCCC ACAATTCTTAAGGGTCATACAGATGGTGTATCTTCGTTTTCTGTGTGGGGCCAAGATGTT ATTTCGATTGCCAGAAATAAAATTGGACTTTCTTCTTTATCCAAATCTGGTGATGAGGAT GGGCAGCAGGCTGTTACATGCCAAAAACTCTACATGGCTGATCATGGAGCAAGAAACTTT TCAGTTTTGTCAAGCATAAGTATTTTACCCTTCTCAAGATTGTTTCTTGTGGGTACAGAA GATGGCTATCTGAGAATATGTTGCTGA
PEP MRNYLGFCLFLFSNEYIGDNYEGCSDSVIANTITSSEVTRDEEEVSSDVNNDQKPKLDSL LNMSPCLSNGGTKTFLQSSACNHSSRFSCSRVISGLAPITHVGICSDSIFEELASEFLSR SLEDHILNSLSLLIEGKASGRDSVNFLNLLGVPSFDENQFPGSLRHPNIAPVLGMVRASN YIDIVLPKTPHTLENIMHYSPDALKSDWHIRFLIYQLLSALAYIHGLGVSHGNICPSSVM LTESCWSWLCICDKPGVGFTPSSRGNRCTTIIPEKVGCSIAGCPSQGLYADLKLSPSIDW HRDFKQWWRGEISNFEYLLILNRLAGRRWGDHTFHTVMPWVIDFSMKPDENSDAGWRDLN KSKWRLAKGDEQLDFTYSTSEFPHHVSDECLSELAVCSYKARRLPLSVLRMAVRSVYEPN EYPSTMQRLYQWTPDECIPEFYCDPQIFHSLHAGMTDLAVPSWACGPEEFIKLHRDALES DRVSRQLHHWIDITFGYKMVGQAAVAAKNVMLPSSEPMMPRSTGRRQLFTQPHPMRRGAI PKPCDSTNGSALYQGKMNELSSDCSVLFETSYLQELEDASAFCEHAMHLSALYGYHLDSV KDIAPVEESSGEYVKKSVTLSDTKKNQWLRHIDTNYLLEHVEVLDEGSSGYQELLLWRQK SSCSKTFSEEIARDIFSVGCLLAELHLRKPLFDPTSLAVYLNSGLLPGLIHELPPHTRLL VEACIQKDCMRRPSAKCLLESPYFPTTVKASYLFLAPLQLLAKGGSRLHYAANFAKQGVL KAMGTFAAEMCAPYCLSLVVTPLSDTEAEWAYTLLKEFIKNLTPKAVKRIVLPAIQRILQ ASYSHLKVSILQDSFVQEIWNQTGKQAYLETVHPLVILNLYAAAHKSSAAAASVLLIVSS EELGLSSDGIDVLVRIGGLLGESFIVRQMLPLLKHVFHSCIDISRMNKPEPVHSWSAFAL IDCLMTIDGLVAFLPREVVAKELIEDKSCLHVLVLMQTSLEYRVLQVAATTLMAFCQRIG PDLTALHVLPQLKELFDELAFSPKTANASTSFGRRLKGSKPKIDGALIESRMDLVLLLYP SFASLLGIEKLRQCCATWLLLEQYLLQYHNWKWEHTGELSRSGSDTILSKRNAFRKGSTS EYSPAKLLLNGVGWSIPQSQGSRSAKNLMPQKRFFEMHQSPAEMHAATSNFKLEPWFWFP SPAASWDGPDFLGRAGGVKDEHPWKIRASVIYSVRAHPGALRYLAVCPDECTVFTAGIGA GFKGTVQKWELTRINCVSGYYGHEEVVNDICVLSSSGRVASCDGTIHVWNSRTGKLISVY SEPSVDSAHSASSPSSSSRVNLDQVNMLSSNTLSGGILTGAFDGSLYTCMHQTEFGEKLV VGTGNGSLRFIDVVRGQKLHLWRGDSTESGYPSLVSTICSCGSDKMQPDGASSPSWIAAG LSSGHCRLFDARSGNVIASWKAHDGYVTKLAAPEDHLLVSSSLDRTLRIWDLRGNWPSQP TILKGHTDGVSSFSVWGQDVISIARNKIGLSSLSKSGDEDGQQAVTCQKLYMADHGARNF SVLSSISILPFSRLFLVGTEDGYLRICC


| Top |