Cherry SNP DataBase

Gene information

Gene Pav_sc0000030.1_g1370.1.mk
Chromosome name PAV_r1.0chr1
start 36267631
end 36269025
PAV_r1.0 name Pav_sc0000030.1
start 737595
end 738989
direction -
Annotation NR PREDICTED: 40S ribosomal protein S5
Sequence CDS ATGGCTGCTGTTGAACCTCCGGCTCCGGCTCCCGTTCCAGTTCCGGCTCCTGCTGCAGTA GAACCCACTTTGCCTCACCACGACGTCAAGCTCTTCAACCGCTGGAGCTTCGACGACGTC CAGGTGAGTGACATCTCCCTGGCCGATTACGTTGGAGTGGTACCAGCGAAACACGCCACT TATGTGCCTCACACTGCTGGGAGGTACTCAGTGAAGCGATTCAGGAAGGCCCAGTGCCCC ATTGTTGAGAGGCTTACGAACTCTCTTATGATGCACGGAAGAAACAACGGGAAGAAGCTC ATGGCTGTCAGGATTATTAGGCATGCCATGGAAATCATCCATTTGCTCACTGACCTCAAC CCAATCCAAGTCATTGTTGATGCTGTTGTTAATAGTGGTCCTCGTGAAGATGCCACTCGT ATTGGGTCTGCTGGAGTTGTTAGGCGTCAGGCTGTGGATATCTCACCTTTGAGACGTGTT AACCAGGCAATCTATTTGCTTACAACCGGTGCTCGTGAGTCGGCTTTCAGGAACATCAAA ACCATCGCTGAATGCTTGGCTGATGAACTGATTAATGCTGCAAAGGGTTCCTCTAACAGT TATGCTATCAAGAAGAAGGACGAGATTGAAAGAGTTGCTAAGGCTAACCGTTAA
PEP MAAVEPPAPAPVPVPAPAAVEPTLPHHDVKLFNRWSFDDVQVSDISLADYVGVVPAKHAT YVPHTAGRYSVKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIIRHAMEIIHLLTDLN PIQVIVDAVVNSGPREDATRIGSAGVVRRQAVDISPLRRVNQAIYLLTTGARESAFRNIK TIAECLADELINAAKGSSNSYAIKKKDEIERVAKANR


| Top |