Cherry SNP DataBase

Gene information

Gene Pav_sc0000030.1_g1470.1.mk
Chromosome name PAV_r1.0chr1
start 36203325
end 36207774
PAV_r1.0 name Pav_sc0000030.1
start 798846
end 803295
direction -
Annotation NR PREDICTED: putative prolyl-tRNA synthetase associated domain-containing protein 1
Sequence CDS CACACAATCTGGTTCTGCGCCTCATCGCCGTCTTCTATTTGCAAACTCTTTCTGGTTTGG CTTTGGCTCTGCAAAACCGGTGAAGCAATTATGGGTCTTTCCAAGGAACAGTTGCTTGCT CGTTTAAAGGAGCTTCAAATTGGTTTTTCCCAGTATGAACATCCTGTTGTTTTGACAGTT GAGGCTCAGGCGAAATATGTTGGACATCTGGGAGGTGGACTGAGTAAAAATTTATTCTTG AAGGACAAGAAGAACAGGTTCTATATTGTTTCTGCTTTGGCAGATACTAAAGTAGATCTG AAAGTTCTATCTATAAGGCTTGGTTTGGGAAAAGGTGGTTTGAGAATGGCTCCTGAAGAA GCACTCGGAGAATTACTTCAGGTCCCACTGGGTTGTGTTACTCCATTTTCGCTGGTGAAT GAATCTGCACGGCATGTCTCTCTGTTGTTGGATCAAAAATTTAAAAGTCAGGAACATTGC TTCTTCCACCCATTGTCGAATGACACATCAATCTCGCTTAGCACCCATGATCTCGATAAG TTCCTTAAATCAATTGGGAGAGACCCCTCATATGTTGACTTGGAGGCTAACCCTTCAGTT GGGAAAGATCAACCGCCAGATCTTGCTTCTCTTGTTCCATCCGGTTCCACAGTGTTGGCC GATCCTCCAGAAGCAGCAGCTTCCTCAAAAGGTTCCATCGAAAATCCAGTTTCGGTCAGT AAAAAGTCAACGACAAGTACAGCAAATGCTACTAAGCCATCCACTAATGCAAAAAATACT AAGGACAAACCAGTCAATGGTGTTCATGTATCAAAGTCCGTAACAGATGTTGGAAAGTTG GTTGAAGATTTACTGGATAAAACATCTGCATTACTGCTTTCAGAGACCACTGAGGAGACT ATTAAGAAACACGGACCACAGTTGGGAGCTGCAATATCAAATAGTATCAGAAGCCATCTT CGTGCAGAGTTGGAGAGCACCATTATGACGTTCAAAAACTCAGCATATACTGAAGGGTTT CATGCTGGTGTGCACCATCATGCAAAGCGTACATATTGA
PEP HTIWFCASSPSSICKLFLVWLWLCKTGEAIMGLSKEQLLARLKELQIGFSQYEHPVVLTV EAQAKYVGHLGGGLSKNLFLKDKKNRFYIVSALADTKVDLKVLSIRLGLGKGGLRMAPEE ALGELLQVPLGCVTPFSLVNESARHVSLLLDQKFKSQEHCFFHPLSNDTSISLSTHDLDK FLKSIGRDPSYVDLEANPSVGKDQPPDLASLVPSGSTVLADPPEAAASSKGSIENPVSVS KKSTTSTANATKPSTNAKNTKDKPVNGVHVSKSVTDVGKLVEDLLDKTSALLLSETTEET IKKHGPQLGAAISNSIRSHLRAELESTIMTFKNSAYTEGFHAGVHHHAKRTY


| Top |