Cherry SNP DataBase

Gene information

Gene Pav_sc0000036.1_g040.1.br
Chromosome name PAV_r1.0chr7
start 10939482
end 10943331
PAV_r1.0 name Pav_sc0000036.1
start 16860
end 20709
direction +
Annotation NR non-ltr retroelement reverse transcriptase
Sequence CDS ATGACTCATATGCAGATGGAGAAGATTTGTACTGAGGGTCGTCTGCAGGTCATATGGATG TTTCTGTTTGCTCTCCAGATCGTCAATTTTACCGGCTCCATTCCTTTTGTGGGCCATTCC TTTACTTGGTCTAATTATCGTGCTGGTGATGATTTTGTTGAGGAACGTCTTGATCGGGGT TTGGTAAATGATACTTTTCTTCTAGACTACCCACATGTGTTATGTCATCATCTGGTCAAC TCTGTCTCTGACCATAAGGCTCTCTTATTTGATGTTTTCACTGATAATGAATTTACTGCA CAACAATCCCGAAAACGCCGGCGTTTTCATTTTGAGGAATTTGGGTTGGTGATTCTGATT GTGAGAGGATTATTCAAGGGGCATGGCAAGGGTCTGATGGTTCTGCAATTGGCTACTGTT CCTTCTCCTATTTACTTGCCAAATCTTAAACTCCTGGAGGCTCGTTTAGATCTTCTACTG GAACAGGAGGAGACAATGTGGCGACAACGCTCTAGAGTAACTTGGCTGCAGCAAGGGGAT AACAATACACGTTTTTTCCATGAAAGGGCAAAAACAAGGCAACGAGTTAATTTAATTCGT CAACTGCAAGATGATCATGGGGTTTGGCAAACCGATTCTGATGCAATTGGTAATATGTTT TGCTCTTTTTTTAGCAATCTTTTTACACGTGTTGGAGGTATTAATATGGATCGTGTTTTG TCTGTTCTGGAGCCTTGTGTTTCTTCCGGTATGAACTCGCATTTACTATCTCCATTTACG CGATCTGATTTGGAAAAGGTTTTATTTCAAATGCCAGCCACTAAATCCCCTGGTGTTGAT GGGATGTCAGCTTTATTTTTTCAAAGGTATTGGCATATTCTTGGTGATGAGGTTAGTCTG CTATGTTTAAGTGTGTTGAATGGTTTGAGTAGTGTCCAGCCTTTTAATCACACTTTGCTC GCCTTGATTCCTAAGCTAAAGTCTCCTTCAAAAGTTGGTGATTTTAGACCAATAAGTTTA TGTACTGTCATTTATAAACTTATTGCAAAATGCTTTGCAAATCGTCTGAAGTTGGTTTTG CAATCTGTCATTTATCATACTCAGAGTGCTTTTGTACCATCAAGGAATATCCTTGACAAT GTCATGGTGGGCTTTGAGGTTATGCATGCTGTCAAAAGGAGGAAAAAGGGTAAACAGGGA GCTTTGGCAATTAAACTGGATATGGCTAAGGCTTATGATAGGGTGGAATGGTGTTATATT GAGGCTGTTATGTTACGGTTGGGATTTGCACAGGAATGGGTACGACGCATAATGGATTGT ATTTCGACTGTTTCCTTTTCGGTGTTATGGCATGGCAATTCTTTTGGTCATTTCAACTCA CAGAGGGGATTACGTCAGGGCTGTCCTTTATCCCCTTATCTTTTCTTGTTTTGTGCTGAA GGCTTTTCTGGTTTACTTCGTTTTGCTGAGAGGAATGGAAGTTTAATTGGGGTCTGTGCT GGTCGTTATGCCCCTCCAATTACGCATTTATTATTTGCATATGACAGTTTATTATTTTTA GAGCAAACTCCAGATGTATGTTCCATATTGAAGAATATCTTTCAAGTGTTTGAAGAAGTA ACAGGTCAGGTAATTAATTTTCAGAAGTCAGCTTTGTCTTTTAGTCCTAATACTTCTATG GAATTTCAACAACTAGTGACTGATTCTTTATTCATTCCGGTGGTGGTTTGCCATGAGGTT TATTTGGGTTTGCCTACTTTGGCTGGTAGGGGAAGAAAGGAATTATTTCGATCTGTTAAA GATCGTGTTTGGCATCGTCTCAATGGGTGGAAAGAAAAACTTCTTTCACAAGCTGGTAAA GAAGTTCTTATTAAATCTGTAATTCAAGCTATTCCTTCTTATCCTATGTGGGTGTTTCAT TTACCAAAAAGCCTATGTAAAGAACTCTCTGCTATGTGTGCGAGATTTTGGTGGGGAAAA ACTCATAATCATCATGGGATCCATTGGCTCAAATGGTCTTCCTTATGTAAAACCAAAAAA GTTGGTGGCCTGGGTTTCAGAGATTTTGAACAATTTAATCAGGCTTTGGTGGCTAAACAA GGTTGGAGGCTTCTCACCAATGCAAATTCTTTTGTGGGGCAGGTGTATCGTGGAAGGTAT TTTCCTAATGGAGATTTTTTGACTGCTCCATTAGGGAATTCTCCTTCACTTATTTGGAGA TCCTTAATTTGGGGTCGGGAATTATTGACTGCTGGTCTTCGTTGGAGAGTAGGTGATGGT TCATCAATTAAAATTAATCGAGATCCTTGGCTGCCTCTGCCGTCCTCTTTTCGGCCTTCT TCACCTCAATTTTTTGGGGATGATGCTACTGTTCAATTTTTAATCGATTCAGCTGGTTGT TGGAATTTAGATTTACTTTCTGCAGTTTTTTGGGAAGAAGAAGTTGCTGCTATTTTGTCC ATTCCTTTGGTACCAAATTCTTCAGATAGGCTAATTTGGCATTATGCTGTGAATGGGAAA TATTGTCAAAAGTGGTTATTGGCTATCTCAAAGTTTAATTTCGAGACAGCAGGGAGATGT AAATGCTCTCAACAGCCTGAAACTGTTATACATGCTCTTTGGTTTTGTCGATTGTCAAGG GAGGTTTGGCAGCATTCGCCTATTCATGATTTGACTATTCCCCTACAGATAAATGTTGAT GGTGCTGTCAATTTGCTGTTTGGATTTAGGGGTTTGGGAGTTGTGATACGGGATAATATG GTTGATTTAATGATGGCTGGCTATAAAGGTCTTCACGGCATGTTTTCTCCTAAAGCTACT GAACTTTATGCAGCAATTTTGGGATTACAGATTGCACGTCAACTGGGACATCTTTCTGTC ATTTTGGAAATGGATGCAAAGGAGATTATTATGAATCTTCAATCTTTTGAGGAAAGCTGG TTGCTCATCTATTGGCTAAGCAGGCACTTCTGA
PEP MTHMQMEKICTEGRLQVIWMFLFALQIVNFTGSIPFVGHSFTWSNYRAGDDFVEERLDRG LVNDTFLLDYPHVLCHHLVNSVSDHKALLFDVFTDNEFTAQQSRKRRRFHFEEFGLVILI VRGLFKGHGKGLMVLQLATVPSPIYLPNLKLLEARLDLLLEQEETMWRQRSRVTWLQQGD NNTRFFHERAKTRQRVNLIRQLQDDHGVWQTDSDAIGNMFCSFFSNLFTRVGGINMDRVL SVLEPCVSSGMNSHLLSPFTRSDLEKVLFQMPATKSPGVDGMSALFFQRYWHILGDEVSL LCLSVLNGLSSVQPFNHTLLALIPKLKSPSKVGDFRPISLCTVIYKLIAKCFANRLKLVL QSVIYHTQSAFVPSRNILDNVMVGFEVMHAVKRRKKGKQGALAIKLDMAKAYDRVEWCYI EAVMLRLGFAQEWVRRIMDCISTVSFSVLWHGNSFGHFNSQRGLRQGCPLSPYLFLFCAE GFSGLLRFAERNGSLIGVCAGRYAPPITHLLFAYDSLLFLEQTPDVCSILKNIFQVFEEV TGQVINFQKSALSFSPNTSMEFQQLVTDSLFIPVVVCHEVYLGLPTLAGRGRKELFRSVK DRVWHRLNGWKEKLLSQAGKEVLIKSVIQAIPSYPMWVFHLPKSLCKELSAMCARFWWGK THNHHGIHWLKWSSLCKTKKVGGLGFRDFEQFNQALVAKQGWRLLTNANSFVGQVYRGRY FPNGDFLTAPLGNSPSLIWRSLIWGRELLTAGLRWRVGDGSSIKINRDPWLPLPSSFRPS SPQFFGDDATVQFLIDSAGCWNLDLLSAVFWEEEVAAILSIPLVPNSSDRLIWHYAVNGK YCQKWLLAISKFNFETAGRCKCSQQPETVIHALWFCRLSREVWQHSPIHDLTIPLQINVD GAVNLLFGFRGLGVVIRDNMVDLMMAGYKGLHGMFSPKATELYAAILGLQIARQLGHLSV ILEMDAKEIIMNLQSFEESWLLIYWLSRHF


| Top |