Cherry SNP DataBase

Gene information

Gene Pav_sc0000037.1_g220.1.br
Chromosome name PAV_r1.0chr4
start 3517990
end 3519496
PAV_r1.0 name Pav_sc0000037.1
start 110947
end 112453
direction -
Annotation NR PREDICTED: fruit bromelain-like
Sequence CDS ATGGATGATGCCTTTAAGTTTGTAATGCGCAACAAAGGCCTGGCAGCTGAAGCAAACTAC CCCTATAGAGGAGTTGATGGAATTTGCAACAAGAAAAAGGTAGCATATCATGCAGCAAAG ATCACAGGTTATGAAGATGTACCAACCAACGAGTCTCATGGGGTGCAGAGTGGGGTGAGG GTGGATATTGGTTTTGGGGACTTGGGAATCAAAAGCCGCATCCACCACGTTGGATATGAA GCTTCTATGGCGATGAAACATGAGCTATGGATGGCTAAGTATGCGCGCATTTACGTAGAC AATGCAGAAAAGGAAAGGCGTTTCAAGATATTCAAAGAAAATGTGGAATTCATCGAAAAG TTTAACACCGAAGTGAATCACACTTACAAGTTAGGCGTCAACAAATTCTCAGACCTCACA GATGAAGAATTCGCCATGTTTCATACTGGATACAAACCCACAGGCTCATTCAAAAATAGT TCTTTCCAGTACGAAAACCTGACTGATGTTCCACCTAGCATTGACTGGAGGAACGAAGGA GCTGTCACCCCCTGTATATGTATTGAGCAGCTTGAGTAA
PEP MDDAFKFVMRNKGLAAEANYPYRGVDGICNKKKVAYHAAKITGYEDVPTNESHGVQSGVR VDIGFGDLGIKSRIHHVGYEASMAMKHELWMAKYARIYVDNAEKERRFKIFKENVEFIEK FNTEVNHTYKLGVNKFSDLTDEEFAMFHTGYKPTGSFKNSSFQYENLTDVPPSIDWRNEG AVTPCICIEQLE


| Top |