Cherry SNP DataBase

Gene information

Gene Pav_sc0000040.1_g1070.1.mk
Chromosome name PAV_r1.0chr3
start 21567189
end 21582274
PAV_r1.0 name Pav_sc0000040.1
start 523057
end 538142
direction +
Annotation NR PREDICTED: cystinosin homolog isoform X1
Sequence CDS ATGGATCGGTTTCGCATGTTGGTCCGTCGGTGGCTACCCACAAGTCATATTGAATTTCCG CAGGAAAAGATGATCCCTGTAGCAGTAAATGATGTTGCTTTCTCAGCTCACGCTGTTTTA ATGACAGCATTTGTTCTGTTCCAAATTGCAATCTATGAACGTGGAACTCAGAAGGTGTCC AAGATTGCCATCGGAATTGTCGTTGCAGTGTGGTCAGGCGCTGCAGTTTGTGTTTTCGTA GCTTTGCCAACCCATTCTTGGCTTTGGCTGATTAATATTTTCAACTCAATTCAAGTTTGC ATGACAGTCGTCAAATATACTCCCCAGGCATTCCTGAACTTCGTGCGGAAGAGCACAGAT GGATTTAGCCTTGGCTCTTACTTGCTTGATTTTTCTGGAGGGGTCACAAATTATGCACAA ATGACTGTGCTTGCTATAGATCAAGATTCTTGGGTGAACTTTTATGGAAACATGGGAAAA GTACTGCTATCTTTGATATCTATATTCTTTGACCTTGTCTTCATGTGTCAACGCTTCCTG CTGTATCCTTCAAAGAAAGCACCCATCCCTCCTCCTCCTCAAATCATCAGCAAGGACAAG GAGAGCTTGGAGCCACTTCTCCAATGGGGAGGGTGGTTCCATAAGAGTAATTCCTTTGCC ATACATGTGGATTCATGGCTGATGCTCCTTGCAGACTTGGTTAGCATACCAAGCAGCTTG GACAATACAAATTTAGGAGCTGGAAATCACATACAGAGTTATGGGATGGATGGCTTTCAC ATGTTGGTCCGTCGGCTTCTACCCACAAATCATATTGAATTTCCGCCGGAAAAGATGATC CCTGTAGCAGTAAATGATGTTGCTTTCTCAGCTCATGCTGTTTTAATGACAGCAATTATT CTGTTCCAAATTGCAATTTACGACCGAGGAACTCAGAAGGTGTCCAAGATTGCCATCGGA ATTGTCGTTGCCGTGTGGTTCGGCGCTGCAGTTTGTTTTTTCGTAGCTTTGCCAACCCAT TCTTGGCTTTGGCTGATCAATATATTCAACTCAATTCAAGTTTTCATGACAGTCGTCAAA TATACTCCCCAGGCATTCATGAACTTCATGCGGAAGAGCACAGATGGATTCAGCATTGGC TTTTACTTGCTTGATTTTTCTGGAGGGGTCACAAATTATGCACAAATGGCTGTGCTTTCT ATAGATCAAGATTCTTGGGTGAACTTTTATGGAAATATGGGGAAAGTTCTGCTATCTTTG ATATCTATATCCTTTGACATTCTCTTCATGTGTCAACGCTTCCTGCTGTATCCTTCCAAG AAAGCACCCATCCCTCCTCCTCCTCCTCCTCCTCAAATCATCAGCAAGGAGAGCTTGGAG CCACTTCTCCAGTCTTCTACATCAGCATCACCCACTCACACTACATATATAGATACAGTT GAAGTTTTAAAAGTCATTGCAAGCAAGCCCCTTTCTTCTCCTTCCTGTCTTCTCCCCTCT CTTCAAAGTTTATCAGACAAGTGGGAAATCGCAATTGCAATTTTGGAAGGGAGGAATGGC TTCGTGGAATTCAGTTCCGCTGGAAATCACATACGAAGTTCTGGGATGGGCGGCATTCAT AAGTTGGTCCATCAGCTTCTACCCACAAGTCATCTTGAATTTCCGGAGGAAAAGATGATA CCTGTTGCAGCAAACGATGTTGCTTTCTCTATTCATGCTGTTTTACTAACAGCAATTACC CTATACCAAATTGCAATCTATGAACGTGGAAATCAGAAGGTCTCCAAGATTTCCATTGGA ATTGTTGCTGCCGTGTGGTTAGGTGCTGCTGTTTGTGTTTTCTTAGCTTTGCCAAGTCAT TCTTGGCTTTGGTTGATTTCCATTTTCAATTTCATAACATCCTTCATGCTAAATTGTGTT TCTAACTTGTGCACCTTTCCAGGTTCTTGGGTGAACTTTTATGGAAATATAGGGAAGACA CTGCTGTCTTTGATATCTATATTCTTTGACCTTCTATTCATGGTTCAACATTACGTGCTG TATCGTGGCAAGAGAGCAGTGATCACCCCTAAAATCATCAGCAAGGAGAGCTCGGAGCCA CTCGTCAAGTCATCTGATGACCCAGTTTCGGAGAATACCAAGGACAAGACCAAAGGGAAC CACAAGCTCAAGTCATCCGACGTCTTATCCAATCATCGTTTGGTCAATTTTTCCGGGTCT TCTGCCACGGGGATTTTGGATCATCTGTCTACTAGTGATTATGATAACAACGATGATGAT GAAGAAGAAGATGATGAAATCAATGGTTATGCAAACGAAAGCCCTAAGACTCTACAGTTT TTCCGATTGGATATTGATGTGCAAGGCGATTGTCGAAGCTCAAAAGATTCCTCTGCCGAA AGGAGTCCGGCAGAACATGACTCTCCGAGAGAGTGTCAAAGTCCAAAAGGTTCCTCTTTT GAGAAGAGGCTGGTGGTTATTGATACTGAGCATGAGTATCAGAGTCCTATTCCTTCTTCT ATTGACAAGAACCAGGTGGAAATTGACTGCGAGGAGTGTGAAACCCCAAAATTTTACTCT ATGATACCTGTTGCAGCAAACGATGTTGCTTTCTCTATTCATGCTGTTTTACTGACAGCA ATTACCCTATACCAAATTGCAATCTATGAACATGGAAATCAGAAGGTCTCCAAGATTTCC ATTGCAATTGTTGCTGCCGTGTGGTTAGGTACTGCAGTTTGTGTTTTCTTAGCTTTGCCA AGTTCTTTGGTGAACTTCTATGGACATATAGGGAAGACACTGCTGTCTTTGATATCTATA TTCTTTGACCTTCTATTCATGGGTCAACATTACGTGCTGTATCATGGCAAGAAAGCAGTG ATCACCCCTAAAATCATCAGCAAGGAGAGCTCGGAGCCACTCGTCAAGTCATCTGATGAC CCAGTTTAG
PEP MDRFRMLVRRWLPTSHIEFPQEKMIPVAVNDVAFSAHAVLMTAFVLFQIAIYERGTQKVS KIAIGIVVAVWSGAAVCVFVALPTHSWLWLINIFNSIQVCMTVVKYTPQAFLNFVRKSTD GFSLGSYLLDFSGGVTNYAQMTVLAIDQDSWVNFYGNMGKVLLSLISIFFDLVFMCQRFL LYPSKKAPIPPPPQIISKDKESLEPLLQWGGWFHKSNSFAIHVDSWLMLLADLVSIPSSL DNTNLGAGNHIQSYGMDGFHMLVRRLLPTNHIEFPPEKMIPVAVNDVAFSAHAVLMTAII LFQIAIYDRGTQKVSKIAIGIVVAVWFGAAVCFFVALPTHSWLWLINIFNSIQVFMTVVK YTPQAFMNFMRKSTDGFSIGFYLLDFSGGVTNYAQMAVLSIDQDSWVNFYGNMGKVLLSL ISISFDILFMCQRFLLYPSKKAPIPPPPPPPQIISKESLEPLLQSSTSASPTHTTYIDTV EVLKVIASKPLSSPSCLLPSLQSLSDKWEIAIAILEGRNGFVEFSSAGNHIRSSGMGGIH KLVHQLLPTSHLEFPEEKMIPVAANDVAFSIHAVLLTAITLYQIAIYERGNQKVSKISIG IVAAVWLGAAVCVFLALPSHSWLWLISIFNFITSFMLNCVSNLCTFPGSWVNFYGNIGKT LLSLISIFFDLLFMVQHYVLYRGKRAVITPKIISKESSEPLVKSSDDPVSENTKDKTKGN HKLKSSDVLSNHRLVNFSGSSATGILDHLSTSDYDNNDDDEEEDDEINGYANESPKTLQF FRLDIDVQGDCRSSKDSSAERSPAEHDSPRECQSPKGSSFEKRLVVIDTEHEYQSPIPSS IDKNQVEIDCEECETPKFYSMIPVAANDVAFSIHAVLLTAITLYQIAIYEHGNQKVSKIS IAIVAAVWLGTAVCVFLALPSSLVNFYGHIGKTLLSLISIFFDLLFMGQHYVLYHGKKAV ITPKIISKESSEPLVKSSDDPV


| Top |