Cherry SNP DataBase

Gene information

Gene Pav_sc0000040.1_g770.1.mk
Chromosome name PAV_r1.0chr3
start 21450824
end 21461359
PAV_r1.0 name Pav_sc0000040.1
start 406692
end 417227
direction +
Annotation NR PREDICTED: pentatricopeptide repeat-containing protein At4g35850, mitochondrial
Sequence CDS ATGGGTGGGAGAAGTTCAAAGGAGGGGAGTTTTAGGCAGAATTCATCTTCTCGTTCTACT TCTTCATCGTGGAGCTATCCTCAAGTTCCATCGCCATATGTTCAATCACCATATGCTCAA GAAAGTCAAAGCTATCCAGCACCCCAGCAAGCCTATCCAGCACCATCACAGCCTTACTAT CCCTCATCGCAGGATTATGGTGGTGGTGCTCGGGCAACTCGTCCTACCTTGGAGAGGAAA TATTCAATAATTTTTTGTAGTTACAAATCCCTAGAGGAGGTGACTGAAGCTCTTGCACGT GCTGGTCTTGAGTCTTCCAATCTTATCGTCGGTATTGATTTCACAAAGAGCAATGAGTGG ACAGGATCGAAGTCATTCAACAGAAAAAGCTTGCATCACATTGGGAATGTTCAAAATCCC TATGAGCATGCCATATCCATTATTGGAAAAACCTTGGCTGCTTTTGATGAGGATAACCTC ATTCCCTGTTTCGGCTTTGGAGACGCGTCAACCCATGATCAAGATGTCTTTAGTTTCTAC TATGATAGATATTGCAATGGATTTGAGGAAGTATTGACTCGCTACAGGGAAATTGTTCCT CAGCTACGGCTTGCAGGACCAACTTCATTTGCACCTGTGATTGAACAGGCCATGACTATT GTCGAGGAGAGTGGTGGCCAGTACCATGTCCTGTTGATAATTGCAGATGGCCAGGTAACT AGAAGTGTAGATACTGACCGTGGCAAGCTAAGTCCACAGGAGCAGAAGACAGTCGACGCC ATTGTTGCAGCAAGCAAGTTCCCTCTATCAATTGTACTAGTTGGTGTTGGAGATGGGCCC TGGGACATGATGAAGGAATTTGATGACAATATTCCTGCTCGGGCATTTGATAATTTCCAA TTTGTGAATTTTACGGAAATTATGTCAAAGAACATGCCACCATCAAGAAAGGAGACCGAA TTTGCTCTAGCAGCCTTGATGGAAATTCCTTCACAGTACAAAGCAACAATAGAGCTTAAT ATATTGGGTGGTAGGATCGGCGATTCTCCCCAGAGGGTTCCTCTCCCCCCACCATCTGTG TTACCAGCGTCATCTTTCAGCAGCTCAAAACCTTCCCGTTCGACAAGTTATAGTTCTCCA TCTTTCAACAGCTCAAAACCTTCCCAATCTACCAGTTTTGAGCCAAGTGTTCCTCCTTAT TATGAAGATAGCACTTCCGTTGGTACAGCTCCACCTGCTCCCAGTTCTACCTATGATAAT CAGGTTTGCCCCATTTGCCTTACGAATCCAAAAGACATGGCCTTTGGGTGTGGGCATCAG GTACATTTGAATGATAATGTTTCTCAAATATTTTGGAGAGTGAAAGTGTTGGCGAGATCA AGGATTACTAGTTGGTGCAAGTTCAGATTCAGAAAGGTTCGTATTAGGAGGAGGAGATCA TTCAAGCTCAAAGTTCCAAGCTTGAAGAGGCTCTTGTTCTTGAGGAGGAAAATTAGGTTG ATCTCTGCTCTCAGAGCTTCATATGCTAAAGTGTTGCAGAGATTCAAGGAAGGGCAAGGC CACTTTGTGAATCAGGAAGGCAGAGTGGAAGGAAGGAAAGAAGGCAGCGAAAGGGAAGGG TTTGGGCCTTTGGGGTTTAGAAGGAGAGAAACTTTCACTCGCACAGAGACACAGCGAGTC AGCAACAGCGACACCATGAGGCTTCTCCAATCCATTACTGGTCAGTGTAGGCCGGTGCTG CTGCGAGCGCTGGGTCGGCGATACTTGGCTGCGGCGTCAACAGAAGAATACGTGAAGAGA AACTACGCGAGCAACTTGTCGGAGTACAATACGGTCTTGAATTCTCTGAATGCTCAGAGA AGGCATTTCTTGCTGAGGGATGTGTATGATGATATGATGCTCGATGGGGTGCAGCCGGAC CAGGACACCTTCAAATCCCTAATATTGGGCACCATGAAAGGCTCTAGCTTGCAGGACGCT TTCTATTTCGCTGATCAAATGAAAACCATGGGCTTGGCCCCTGATGTTAATTCATATAAC ATTTTGATCACATTGTGTGGGAAGTGCAAGCACTCTGACAAAGCTATTCAGATTTTGGAA GATATGAAGAAGTTTGACGTGAAACCGAAGGTGCAAACTTACATGTGTCTACTCAATGCA TGTGCAGCTACTGGCCATTTAGATCGAGTGTATGCAATTGTCCGTGACATGACCGCTGCT GGTCTTGGATTAAACAAGTTCTGCTATGCAGCACTTATAACCGCACTTAGGAACAAGACA CCCTTACCAGATGATTTTGGCACCAAAAGTTCTCTAATATTCCCCTTTTGCAATAAGATT ATAGAGTTTGTTGAAAGGTCAAAAGAGTGGACATCGGTTGAAGAATCAAGTATGACTGCT GAAAATGTAATGATGGACATAACAGAAGAAGAGTTATATAATATGCCCACTGCTGAATAT GCTCGTAGGCGTGGATTTTTGAATAGGCAACTAACCGTGTATCATGCTGCGCTTCATGCT TGTGCAGAACTCAGGAATGTAGAGGTGATGGAAGCTCTTTTGGAGATGCTAGAGAAAGAT GGAAAAACTCCTGACCTCTTTATTGTGATGCAAAAGATGAGGTGCTATCTACAGTCTGGG GACATTGACCGTGGTCTTAAGACGTTTGACGACTATATGAAGTCAGGAAATCTTCCCGCA GTAGAATTATATACGGTAAATATGACTTCCCGGAACTTTTATTTGAGCCCAAAAATGGGG AGTGATCTTCTCCTTGCAGCTGCTGGTGACGAGACTGGAGGTTATGCTGTTGCCAACTAT ATATGGGACTTGATGCAAGCTCGTAATATAATTCCTCAATTTCCTGCTGTAGAAGCATAT TACAAGGGCTTAAAAAAACGTGAGATTCCCGGGGATGATCCACGACTGTTAGTGGTTACG CGGACTTACGATGATTTTCTCGCAAGAAGGGGACCCAGACGACCTTCCAGATAA
PEP MGGRSSKEGSFRQNSSSRSTSSSWSYPQVPSPYVQSPYAQESQSYPAPQQAYPAPSQPYY PSSQDYGGGARATRPTLERKYSIIFCSYKSLEEVTEALARAGLESSNLIVGIDFTKSNEW TGSKSFNRKSLHHIGNVQNPYEHAISIIGKTLAAFDEDNLIPCFGFGDASTHDQDVFSFY YDRYCNGFEEVLTRYREIVPQLRLAGPTSFAPVIEQAMTIVEESGGQYHVLLIIADGQVT RSVDTDRGKLSPQEQKTVDAIVAASKFPLSIVLVGVGDGPWDMMKEFDDNIPARAFDNFQ FVNFTEIMSKNMPPSRKETEFALAALMEIPSQYKATIELNILGGRIGDSPQRVPLPPPSV LPASSFSSSKPSRSTSYSSPSFNSSKPSQSTSFEPSVPPYYEDSTSVGTAPPAPSSTYDN QVCPICLTNPKDMAFGCGHQVHLNDNVSQIFWRVKVLARSRITSWCKFRFRKVRIRRRRS FKLKVPSLKRLLFLRRKIRLISALRASYAKVLQRFKEGQGHFVNQEGRVEGRKEGSEREG FGPLGFRRRETFTRTETQRVSNSDTMRLLQSITGQCRPVLLRALGRRYLAAASTEEYVKR NYASNLSEYNTVLNSLNAQRRHFLLRDVYDDMMLDGVQPDQDTFKSLILGTMKGSSLQDA FYFADQMKTMGLAPDVNSYNILITLCGKCKHSDKAIQILEDMKKFDVKPKVQTYMCLLNA CAATGHLDRVYAIVRDMTAAGLGLNKFCYAALITALRNKTPLPDDFGTKSSLIFPFCNKI IEFVERSKEWTSVEESSMTAENVMMDITEEELYNMPTAEYARRRGFLNRQLTVYHAALHA CAELRNVEVMEALLEMLEKDGKTPDLFIVMQKMRCYLQSGDIDRGLKTFDDYMKSGNLPA VELYTVNMTSRNFYLSPKMGSDLLLAAAGDETGGYAVANYIWDLMQARNIIPQFPAVEAY YKGLKKREIPGDDPRLLVVTRTYDDFLARRGPRRPSR


| Top |