Cherry SNP DataBase

Gene information

Gene Pav_sc0000044.1_g440.1.mk
Chromosome name PAV_r1.0chr7
start 14097120
end 14099933
PAV_r1.0 name Pav_sc0000044.1
start 243815
end 246628
direction -
Annotation NR PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic
Sequence CDS ATGGCTGCAGCTGTAACTGCTGCTGTCTCATTCCCATCCTCCAAGTCCTCCTCTCTTCCC AGCAGGACCTCTATAATCTCACCTGATAGAATCACCCTCAAGAAGGTTCCTTTGTACTAC AGAGATGCCTCTGCTAGTGGGAGAGTGGTTTCCATCAGAGCCCAGGTCACCACCACTGAG GCTGCTCCTCCTGCCAAGGTTGTGAAGGAATCCAAGAAGCAAGATGAAGGTGTGGTTGTT AACAAATACAAGCCCAAAAATCCCTACACTGCCAGAGTCCTTCTCAACACTAAGATCACT GGTGATGATGCTCCTGGAGAAACCTGGCACATGGTCTTCAGCACTGAGGGAGAGATTCCC TACAGAGAAGGGCAGTCCGTTGGAGTAATTCCAGATGGTATTGACAAGAATGGGAAGCCT CACAAGCTAAGGTTGTACTCAATTGCCAGTAGTGCCCTTGGTGACTTTGGAGACTCCAAA ACTGTTTCTCTGTGTGTGAAACGGCTTGTGTACACCAATGACCAAGGAGAAATTGTTAAA GGAGTGTGTTCAAACTTTTTGTGTGACTTGAAGCCAGGGAGTGAAGTCACGGTCACAGGA CCAGTTGGAAAAGAAATGCTTATGCCAAAAGATCCTAATGCGACCATCGTCATGCTTGCA ACTGGAACTGGAATTGCTCCTTTCAGATCATTCTTGTGGAAAATGTTTTTTGAGAAGCAT GAAGACTACAAGTTCAATGGTTTGGCATGGCTCTTCTTGGGTGTTCCCACAGGTAGCTCA CTGCTTTACAAGGAGGAATTTGAGAAAATGAAAGAGAAGGCCCCAGAAAACTTCAGGCTT GACTTCGCTGTCAGCAGAGAGCAAACCAATGAGAAGGGCGAGAAGATGTACATTCAAACA AGAATGGCTCAGTATGCAGAAGAGCTATGGGAGTTGCTCAAGAAAGACAACACCTACATC TACATGTGTGGTCTCAAGGGAATGGAGAAGGGAATTGATGACATCATGGTGTCATTGGCT GCTAAAGATGGCATTGACTGGACAGACTACAAGAAGAAGTTGAAGAAAGCAGAGCAATGG AATGTGGAAGTCTACTAA
PEP MAAAVTAAVSFPSSKSSSLPSRTSIISPDRITLKKVPLYYRDASASGRVVSIRAQVTTTE AAPPAKVVKESKKQDEGVVVNKYKPKNPYTARVLLNTKITGDDAPGETWHMVFSTEGEIP YREGQSVGVIPDGIDKNGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNDQGEIVK GVCSNFLCDLKPGSEVTVTGPVGKEMLMPKDPNATIVMLATGTGIAPFRSFLWKMFFEKH EDYKFNGLAWLFLGVPTGSSLLYKEEFEKMKEKAPENFRLDFAVSREQTNEKGEKMYIQT RMAQYAEELWELLKKDNTYIYMCGLKGMEKGIDDIMVSLAAKDGIDWTDYKKKLKKAEQW NVEVY


| Top |