Cherry SNP DataBase

Gene information

Gene Pav_sc0000044.1_g910.1.mk
Chromosome name PAV_r1.0chr7
start 13808658
end 13810502
PAV_r1.0 name Pav_sc0000044.1
start 533246
end 535090
direction +
Annotation NR PREDICTED: protein FMP32, mitochondrial-like
Sequence CDS ATGCCCAAGCTGAATGCTTCATCTGATGAAGTTTTAGTCAAAAGCAATAACAATCAAAAT GGAGGTGGAAATGGAGGAGGAGGTGGTGGTGGTGGAGGAGGTGGAGGTGGAGGCGGAAAT GGTGGTCGAGGTGGGGGAAGTGGTGGCGGAGCAGGTGGTGGGAATGGTGGAGCTAGTGGA GATGGAAGAGGTAAAGGAGAAGGTAGAGGCCACAAAAGAAAAGGAAATGGTAGAGGAAGA GGAAGAGGAAGAGGCTGTGGACACCATTTTTCTTCGTTGCAACACGAGACTGAAAAACTT AGGAATGATATAGAGAAGATGCGTAGCGAATTGAGGTATGAAATCGACAAAGTTACTGCA GGGCAGCGGTTGGACTTGAATCTTGAAAGGGGGAGGATACGGGAAGAGCTATCAAATCAG AATGCAGAAACCAATAACCTTACTAACAAACTTGATCGGGAAATTCATGCTCTAAGGGCA CAGGTGGAAGCAGCAAAATATGATGTCATAAAATACTGCATAGGTACTCTTGTTTCCATT TCTGCTGTTGGTCTTGCTGTGCTTCGTATCTTGATGTAA
PEP MPKLNASSDEVLVKSNNNQNGGGNGGGGGGGGGGGGGGGNGGRGGGSGGGAGGGNGGASG DGRGKGEGRGHKRKGNGRGRGRGRGCGHHFSSLQHETEKLRNDIEKMRSELRYEIDKVTA GQRLDLNLERGRIREELSNQNAETNNLTNKLDREIHALRAQVEAAKYDVIKYCIGTLVSI SAVGLAVLRILM


| Top |