Cherry SNP DataBase

Gene information

Gene Pav_sc0000052.1_g340.1.mk
Chromosome name PAV_r1.0chr4
start 20978248
end 20983914
PAV_r1.0 name Pav_sc0000052.1
start 111889
end 117555
direction +
Annotation NR PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like
Sequence CDS ATGGCCATCCCAGCTGTACTCGCCATCGTTCCCATTGGCGTTCTTTTCATTCTCTCAGGC CTCATTGTTAATCTCATGCAGGTAGTTTCTTTCATCCTTCTTCGTCCTATATCAAAGAAG TTGTATAGAAAGATCAACAAAGTAGTTGCAGAGTTGCTTTGGTTGGAACTCATATGGCTT ATTGATTGGTGGGCAGGCATCAAGGTTGAGTTGTATGTAGATTCTGACACCTTTCAGTTA ATGGGTAAAGAACATGCGCTTGTCATTTGCAATCACAGAAGTGACATTGATTGGCTTGTT GGATGGCTCGTAGCTCAGCGCTCAGGTTGCCTTGGTAGTGCGCTAGCCATCATGAAGAAA GAAGTAATGTTCCTCCCAGTCATAGGTTGGTCAATGTGGTTTTCTGAATATTTCTTCTTG GAAAGAAGATGGACTAAAGATGAAATTACATTGAAGTCAGGTTTTCAACAACTAGAGGAT TTCCCCATCCCTTTTTGGTTGGCTCTCTTTGTAGAAGGAACGCGATTTACGCAGGCAAAG TTAATGGTAGCTCAAGAGTTTGCTGCTTCAAGAGGGTTGCCTATTCCTAGGAATGTCTTG CTTCCACGTACAAAGGTAAAATTACAAATCAGGAGACATCCAATGCAGGAATTGCCCGAA ACAGCTGACGGAATTGGACAGTGGTGTAAAGATGTATTTGTTACCAAGGATGCTTTACTG GAGAAGTACTTTGCTAAAGGCGCATTCAGTGACCAGCAACTCCAAAACATTGGCAGACCT ATGAAGTCCTTAATTGTTGTGTTACTCTGGTCCTGCCTACTTGGCTATGGAATTTTCAAA TTTGTTCCATGGTCTGCCCTCCTATCCTCATGGAAAGGCATTGCATTTTCAGCTACTTTC TTCGTCCTTATTGTAATTGTTATGCAAATCCTCATCCATTCATCTGAATCAGAGCGTTCG ACACCTCTCAATATAACCCCACAAGACCAAACCAAGGAGAGACTCGTTCAGAAATGA
PEP MAIPAVLAIVPIGVLFILSGLIVNLMQVVSFILLRPISKKLYRKINKVVAELLWLELIWL IDWWAGIKVELYVDSDTFQLMGKEHALVICNHRSDIDWLVGWLVAQRSGCLGSALAIMKK EVMFLPVIGWSMWFSEYFFLERRWTKDEITLKSGFQQLEDFPIPFWLALFVEGTRFTQAK LMVAQEFAASRGLPIPRNVLLPRTKVKLQIRRHPMQELPETADGIGQWCKDVFVTKDALL EKYFAKGAFSDQQLQNIGRPMKSLIVVLLWSCLLGYGIFKFVPWSALLSSWKGIAFSATF FVLIVIVMQILIHSSESERSTPLNITPQDQTKERLVQK


| Top |