Cherry SNP DataBase

Gene information

Gene Pav_sc0000055.1_g700.1.mk
Chromosome name PAV_r1.0chr7
start 9927314
end 9932791
PAV_r1.0 name Pav_sc0000055.1
start 395841
end 401318
direction -
Annotation NR PREDICTED: putative F-box/FBD/LRR-repeat protein At4g03220
Sequence CDS ATGGAACACAAACCTAAGTTAATGGCTACTGTAAGTCGTCAAGGTCAAGGAGTGCATGCT GAGAGTATAATGATAGATAGATTGAGTAATCTTCCAGACCCTATCGCCCATCACATTTTT TCCTTCGTTGATCTAAAAGACATCGTACGAGTGGGCTGTGCGTCCAAAAGATGCAGACAA TTTCACCTGTCAACTCCAACTTTGAGTTTCAATTTCAATGAATTTCCCGACATGAAGAAA TCCCCGTGTAGCAAGAGATTAGAGGCTCTGTTAAAGGAAGGTCCTATGCCAACACTCTTT TGTGCTCGGATTCATTATTTACAAATGCACATGGAGGGCTTGTTTGATTTTCTAGTCCCT GCAATGGTCTGTTTTTTTCGAGGAATGCCAAGTTTGAATACTTTGTACCTAAAATCTGAC CAAATCACCTTCCACCCTGAAGCTAGATTAAATGAAAGCAAGAAAGCTCCCAATGCCATA GTTGTCTTTGAAGAAGATCAAGAAAGAGGAACAAGAAAGCATGGACCTCGCGCACACCCA ATGGAACACAAGAGCAAGCTAATGGCAACTGCAAGTAGGCCAGGTCAAGCACGAATGCAT GCTAAGAGTAGAAGGGTAGACATATTTAGTCATCTTCCTGACGAAGTTGCCCTTCGCATT CTTTGCCGCCTTTCTATAAAAGACCTCACTCATTTCGGCTGTGTGTCGAAAAGATGTAGA CAACTCTACCTGTTGTCTCCAGTATTGCATTTTGATGAATTTCCCAAGGCAAATACATTG ACGTGTGGTAAAAGGCTGAAATTGTTGAACTGTTTGGATAGGTATTTGGCTCTGTTTAGG GATGGATCCATGCCAGCTCCATTTGAAAATATTCGCCATTTGCGTGTTCATATTAGGAGC TTTATTAATGACCTAGTACCAGCAATGGTCTTTCTTTTTTCTGGACTGCATAACTTGTAT ACCTTATACATAAAGTCTAGCCCGCCTTTAGTCGAGCCCGAATCTAAT
PEP MEHKPKLMATVSRQGQGVHAESIMIDRLSNLPDPIAHHIFSFVDLKDIVRVGCASKRCRQ FHLSTPTLSFNFNEFPDMKKSPCSKRLEALLKEGPMPTLFCARIHYLQMHMEGLFDFLVP AMVCFFRGMPSLNTLYLKSDQITFHPEARLNESKKAPNAIVVFEEDQERGTRKHGPRAHP MEHKSKLMATASRPGQARMHAKSRRVDIFSHLPDEVALRILCRLSIKDLTHFGCVSKRCR QLYLLSPVLHFDEFPKANTLTCGKRLKLLNCLDRYLALFRDGSMPAPFENIRHLRVHIRS FINDLVPAMVFLFSGLHNLYTLYIKSSPPLVEPESN


| Top |