Cherry SNP DataBase

Gene information

Gene Pav_sc0000064.1_g070.1.mk
Chromosome name PAV_r1.0chr7
start 11292161
end 11313346
PAV_r1.0 name Pav_sc0000064.1
start 25032
end 46217
direction -
Annotation NR PREDICTED: protein SHOOT GRAVITROPISM 6
Sequence CDS ATGTGCCTGTTTTTACGTCAAGTTTCTTTTAAATGTTGGTGTCAGGCTGTTTGGCAATAT AGTCTTGATATCCCTTCGCAGTCACCTCTGGATGGTGACATCATGTCATTTCTGAATTCT GTTTTTGAGCTTTTGTTGAGAGTTTGGGCGGCTTCACGGGATCTAAAGGTTCGCATATCT TCTGTAGAAGCATTAGGTCAGATGGTTGGCCTTATTACCCGGGCACAATTGAAGGCGGCT TTACCCAGACTTGTCCCCACAATATTGGAATTGTATAAAAGAGATCAAGATATTGCCTTT TTGGCCACATGCAGTCTTAACAATCTCTTACATGCTTCTTTACTATCAGAAAGTGGTCCT CCTTTACTTGATTTTGAGGAGCTCACAGTCATTCTATCAACACTCCTGCCGGTGGTTTGC ATCAATAATGACAACAAGGAGCATTCAGATTTCTCAGTTGGACTGAAGACATATAATGAA GTTCAACGTTGCTTCCTGACAGTTGGTTTGGTATACCCTGAGGATTTATTTGTGTTTCTT ATTAATAAATGCAGATTGAAGGAAGAACCTTTGACGTTTGGTGCGCTATGTGTTCTAAAA CATCTCTTGCCAAGGCTATCTGAAGCTTGGCACTGTAAACGGCATAATCTTGTTGAAGCT GTACAATTCTTGCTAGATGATCAAGATTTAGGTGTCCGAAAGGTGCTTTCAGAGTTGATT GTTGTTATGGCTTCGCATTGTTACTTAATTGGTCCGTCTGGGGAGCTGTTTGTGGAATAT CTTGTCCGCCATTGTGCTTTAACAGATAAGGATAGTAATGACCTTGAGAGGTCCAAGGAT GCATCAGGCAACCCCTATATTCCTTTCCAATACAAGAGATTGGAGGTGAAAATTGGGACA CTTTGTCCAGCAGAGTTAAGGGCAATCTGTGAAAAAGGCCTTCTTCTGCTGACTATTACG ATCCCAGAAATGGAGCATATACTTTGGCCTTTTCTGCTGAAGATGATTATTCCACAGGCT TATACTGGTGCAGTTGCTATGGTTTGCAGATGCATCTCAGAATTGTGCAGGCATAGATCT AATAGCAATACCATGCTTGCTGAGTGCAAAGCTCGTGCTGATATACCAAATCCTGAGGAG CTTTTTGTTCGCTTGGTGGTGCTTTTGCATGATCCTTTAGCAAGGGAGCAGCTGGCGAGT CAGATTTTGACAGTTCTTTGCTATCTGGCACCTCTCTTTCCAAAAAATATCAACTTGTTT TGGCAAGATGAGATTCCAAAATTAAAGGCATATGTTAGTGACACAGAAGATTTAAAGCAA GATCCTTCTTATCAAGAGACTTGGGACGACATGATAATCAATTTTTTTGCAGAATCTTTG GATGTGATTCAAGATTCTGACTGGGTGATACCCTTTGGAAATGCAATTACCAAACAGTAT GGACTTTATACATCTGATGACGAACACTCTGCACTTCTTCATCGCTGCTTTGGTGTGTTT CTTCAAAAAGTGAATGACAGGGCCTATGTCCGTGATAAGATAGATTGGATGTATAAACAA GCTAACATCACAATTCCAACAAATAGGCTTGGTTTGGCAAAAGCCATGGGGCTGGTTGCA GCATCCCACTTGGACACAGTCCTGGAAAAGCTAAAAGGCATTCTGGATAATGTTGAGCAA AGCATTTTTCGAAGATTCTTATCTTTTTTCTCTGATGATTTTAAAACCGAAGAATCTGAT GATATACATGCTGCTTTGGCTCTAATGTATGGATATGCTGCAAAATATGCTCCATCAACA GTAATTGAAGCCAGAATAGATGCACTTGTGGGGACTAATATGCTCTCACGGCTTCTTCAT GTGCGCCACCCTACTGCAAAGCAAGCAGTCATTACTGCTATTGATTTACTCGGTCGTGCT GTCATTAATGCTGCAGAAAATGGTTCATCATTTCCATTAAAAAGAAGGGACCAAATGCTT GACTATATATTAACTTTAATGGGACGAGATGACAGTGAAAGCTTTTCAGATTCTAGTCTG GAACTTCTGGACACGCAAGCCCGTGCTTTAAGTGCCTGCACTACATTGGTCTCTGTGGAC CCAAAACTAACGATTGAAACCAGAAACCATGTATTAAAGGCCACCTTAGGGTTCTTTGCT TTACCAAATGATCCAATAGATGTCGTCAATCCTCTTATTGACAACCTCATTACTCTCTTG TGTGCAATTCTTCTTACAAGTGGAGAAGATGGGAGAAGTCGAGCAGAGCAGTTATCGCAC ATCTTGAGACAAATTGATCAGTATGTTTCTTCACCTATGGATTATCAAAGGAGAAGAGGT TGTCTTGCAGTACATGAGATGCTTCTCAAGTTTAGGACAGTTTGCATCACTGCACATTGT GCCCTGGGCTGCCAAGGAAGTTGCACGCACAACAAGAAATTTGACCGTAACTTGCATGGG AACTTGTCCAACTTACCATCGGCTTTTGTATTGCCAAGTCGTGAGGCCTTGTCATTGGGA GACAGGGTCATTATGTATCTTCCACGTTGTGCAGACACTAATTCTGAAGTTAGAACAGTC TCTGCTCAGATTCTTGATCAGCTTTTTAGCATCTCACTTTCACTTCCACGGCCTGAAACT TCCAGTTATGGTGTGGACATAGAATTGTCCTACAGTGCTTTATCGTCCCTTGAGGATGTC ATTGCTATTTTGAGGAGTGATGCTTCTATAGATCCATCTGAGGTTTTCAACAGAATTATT TCCTCTGTCTGCATATTACTGACAAAAAACGAGCTTGTAGCTACTCTGCATGGTTGCACA TCAGCTATATGTGATAAGATCAAGCAATCAGCTGAAGGGGCCATTCAAGCTGTAATTGAG TTTGTCACAAGAAGAGGGAATGAACTGAGTGAAGCTGATGTTTCAAGGACGACCCAAGCT CTGCTGATGGCTGCAAACCATGTAACTGAGAAGCATTTACGTCAGGAAACTCTTGCTGCT ATTTCTTCTCTAGCTGAGAGCACTAGTTCGAAAGTTGTCTTCAATGAAGTTTTGGCTACG TCTGGAAGGGATATAGTAACAAAAGATATATCTAGACTACGTGGTGGCTGGCCAATGCAG GATGCATTTTATGCATTTTCCCAGCATACAGTTCTTTCATCTTTGTTCCTGGAGCATGCG ATAGGTGTCTTTGGCCAGTATCCCATCCTTAAAGGTGATTCAGTAAAAGGAGACAGTCAT AGCCATTTGGTTGACAGTCAAATGGAGGATGACATTCTACAAGCTGCTATTATTGCTGTC ACTGCATTTTTCAGGGGTGGTGGTAAAATAGGCAAGAAGGCTGTTCAACAAAATTATGCC TCTGTTCTTGCTGAACTCACTCTCCAATTGGGAACTTGTCATGGTCTAGCTAGCTGTGGT CAACATGATCCATTACGGGCTCTTCTAACTGCATTCCAAGCGTTCTGTGAATGTGTTGGA GATCTTGAGATGGGAAAGATTCTGGCTAGAGATGGAGAGCATAATGAAAATGAGAGGTGG ATCAATCTTATTGGAGACATAGCGGGCTGCATCTCTATAAAAAGACCAAAAGAGGTTCAA AGCATATGTGTAATTTTAAGTAAATCATTAAATCGACACCAAAGATACCAAAGGGAAGCT GCAGCTGCTGCATTATCAGAGTTTGTCCGCTACAGTGATGGATTTGGCTCCCTATTAGAG CAGATCGTGGAGGTGTTGTGTCGACATGTATCAGATGAGTCTCCAACAGTTAGGCGCTTG TGTTTGAGAGGACTAGTACAGATACCCTCAATCCATATGTTGCAGTACACAACTCAAGTT CTGGGTGTAATATTAGCTTTACTCGATGATTCTGATGAATCTGTGCAATTAACTGCAGTC TCTTGCTTACTCACGATGCTTGAGTCATCACCCAACGATGCAGTGGAACCCATTTTGCTT AATCTTTCTGTACGGCTTCGAAATCTTCAGATATGCATGAACCCAAAGATGCGAGCTAAT GCTTTTGCAGCTTTTGGAGCACTAAGCAACTACGGAATTGGGGCACAGCACGAAGCATTT CTTGAGCAGGTACATGCTGCCATCCCACGCTTGGTCCTGCATTTGCATGATGATGATGTT AGTGTGCGACAGGCTTGCCGGGTAATTGAGTACTCTCAAACGAATTGCCCCCTTGCTGGA AATGGAAGGATTGTTGCCCTTGTTCAACATGCATTGCTTCAATCATGA
PEP MCLFLRQVSFKCWCQAVWQYSLDIPSQSPLDGDIMSFLNSVFELLLRVWAASRDLKVRIS SVEALGQMVGLITRAQLKAALPRLVPTILELYKRDQDIAFLATCSLNNLLHASLLSESGP PLLDFEELTVILSTLLPVVCINNDNKEHSDFSVGLKTYNEVQRCFLTVGLVYPEDLFVFL INKCRLKEEPLTFGALCVLKHLLPRLSEAWHCKRHNLVEAVQFLLDDQDLGVRKVLSELI VVMASHCYLIGPSGELFVEYLVRHCALTDKDSNDLERSKDASGNPYIPFQYKRLEVKIGT LCPAELRAICEKGLLLLTITIPEMEHILWPFLLKMIIPQAYTGAVAMVCRCISELCRHRS NSNTMLAECKARADIPNPEELFVRLVVLLHDPLAREQLASQILTVLCYLAPLFPKNINLF WQDEIPKLKAYVSDTEDLKQDPSYQETWDDMIINFFAESLDVIQDSDWVIPFGNAITKQY GLYTSDDEHSALLHRCFGVFLQKVNDRAYVRDKIDWMYKQANITIPTNRLGLAKAMGLVA ASHLDTVLEKLKGILDNVEQSIFRRFLSFFSDDFKTEESDDIHAALALMYGYAAKYAPST VIEARIDALVGTNMLSRLLHVRHPTAKQAVITAIDLLGRAVINAAENGSSFPLKRRDQML DYILTLMGRDDSESFSDSSLELLDTQARALSACTTLVSVDPKLTIETRNHVLKATLGFFA LPNDPIDVVNPLIDNLITLLCAILLTSGEDGRSRAEQLSHILRQIDQYVSSPMDYQRRRG CLAVHEMLLKFRTVCITAHCALGCQGSCTHNKKFDRNLHGNLSNLPSAFVLPSREALSLG DRVIMYLPRCADTNSEVRTVSAQILDQLFSISLSLPRPETSSYGVDIELSYSALSSLEDV IAILRSDASIDPSEVFNRIISSVCILLTKNELVATLHGCTSAICDKIKQSAEGAIQAVIE FVTRRGNELSEADVSRTTQALLMAANHVTEKHLRQETLAAISSLAESTSSKVVFNEVLAT SGRDIVTKDISRLRGGWPMQDAFYAFSQHTVLSSLFLEHAIGVFGQYPILKGDSVKGDSH SHLVDSQMEDDILQAAIIAVTAFFRGGGKIGKKAVQQNYASVLAELTLQLGTCHGLASCG QHDPLRALLTAFQAFCECVGDLEMGKILARDGEHNENERWINLIGDIAGCISIKRPKEVQ SICVILSKSLNRHQRYQREAAAAALSEFVRYSDGFGSLLEQIVEVLCRHVSDESPTVRRL CLRGLVQIPSIHMLQYTTQVLGVILALLDDSDESVQLTAVSCLLTMLESSPNDAVEPILL NLSVRLRNLQICMNPKMRANAFAAFGALSNYGIGAQHEAFLEQVHAAIPRLVLHLHDDDV SVRQACRVIEYSQTNCPLAGNGRIVALVQHALLQS


| Top |