Cherry SNP DataBase

Gene information

Gene Pav_sc0000065.1_g840.1.mk
Chromosome name PAV_r1.0chr1
start 6069118
end 6070530
PAV_r1.0 name Pav_sc0000065.1
start 601899
end 603311
direction -
Annotation NR PREDICTED: putative GDP-L-fucose synthase 2
Sequence CDS ATGAGTGGCGCCATTGACGTGAAGAAGCTCTTGTTTCTCGGCTCCTCTTGTATTTACCCC AAGTTCGCTCCACAGCCTATCCCCGAAAGCGCATTGTTAACGGGCCCTCTGGAGCCCACA AATGAGTGGTATGCGATTGCCAAGATCGCCGGGATCAAGATGTGCCAGGCTTACCGGATT CAGTACAATTGGGATGCGATTTCGGGGATGCCCACCAATTTGTATGGGCCACATGACAAC TTTCACCCCGAGAATTCCCATGTTTTGCCGGCATTGATGAGGCGGTTTCACGAGGCAAAG GTAAAGGGTGCGAAGGAGGTGGTGGTGTGGGGGTCTGGAAGCCCCTTGAGGGAGTTTTTG CACGTTGACGACTTAGCGGATGGGGTTGTGTTCTTGATGGAGAATTATGGTGGGCTAGAG CATGTCAATGTGGGTAGTGGCAAGGAGGTGACTATCAAGGAGTTGGCTGAGTTGGTGAAG GAAGTGGTTGGGTTTGAGGGTGAGCTTGTTTGGGACTCTTCCAAGCCTGATGGAACTCCG AGGAAGCTCATGGATAGCTCAAAGCTGGCGGGGTTGGGTTGGACCCCAAAGATCTCTCTC AAGGATGGTCTAGTTGATACCTATAAGTGGTACTTGGAGAATGTCAAGCAATGA
PEP MSGAIDVKKLLFLGSSCIYPKFAPQPIPESALLTGPLEPTNEWYAIAKIAGIKMCQAYRI QYNWDAISGMPTNLYGPHDNFHPENSHVLPALMRRFHEAKVKGAKEVVVWGSGSPLREFL HVDDLADGVVFLMENYGGLEHVNVGSGKEVTIKELAELVKEVVGFEGELVWDSSKPDGTP RKLMDSSKLAGLGWTPKISLKDGLVDTYKWYLENVKQ


| Top |