Cherry SNP DataBase

Gene information

Gene Pav_sc0000067.1_g330.1.mk
Chromosome name PAV_r1.0chr3
start 8655282
end 8659875
PAV_r1.0 name Pav_sc0000067.1
start 167859
end 172452
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103328503 isoform X2
Sequence CDS ATGATGCTAAAGAATCTGATGGAAGAGAAGCAGTTGAACTTCAATCAGCCACTTCTATCT GTGAGACGATTTTCAGCGACAGTGGTCTCCTCAGAAGCTGATGAAAAAAGGAAGACTGAA AAGTCCCTACCCAAACTACCTCCCCTTCCCGTTTACAAATCAGAGTTGAAATCAGGTCCC GTGAGGAACCCCGGAACTGTTCCTTTTGTATGGGAGCAAATCCCAGGAAGACCCAAGGAT GAAAGAAAATCACCAAATCAAGCTCTTGAATGGCTTCCCACTGCACCAAAGCTTCCGCCT GGAAGGGTTTCAAAGGTTAAGAAGCAAGCAACGGATAAAGGTTCTAAATGTACAACTGCT GCTCAATCACCAACTGGAAATGTACTTTCGAATTCTCAAAATGTTTCAACCTTGGATACA AAAGAAGCTACTAAATATGACAGCTCTAAAGTGGAGATGGAGGAAAAGGGTATTGCTGGT TCAGACGATGGTGATGAGACCTATTTAGATGCACTTTCTAGGAGTGAATCATTCTTTATG AACTGTAGTGTAAGTGGTTTGAGTGGACTGGATGGTCTAGATATCAAACCATCTGGAACC TTCTCAACAGATCCACAGACTCGGGATTTCATGATGGGCCGGTTCTTGCCTGCAGCAAAA GCTATGGCTTCAGAAACACCTCAATATGCTAGCAGGAAGCAACCAGTTGCCCGAGAGCAA CCACTTTTGCAAGAGCAACCAAGTGGGATGAAGAAGGTAGTAAGTTTGGATAAGCAACTT CCGCTTAATCAACATAGGCCAAAGGATTTGCCACATTATGTTCAAGATATAGCTGGGGAC AAAAGTGAGGATGAAGGTATGAGAGTGCAAGCGCAATTACCCATTTCTTCAGTTAGGAGA GTGCGGGCTAAATCTTCTTATGCCATTTCGTACAGAGAAGCTAAAAAAGAGGGCCGTATT ATTGATTACAGAGGGAATGGTTTTGAAATTCGTGAGAAAAGTGATAAAGTGGAAGAAATA ACCCATTCGGTAGAGTCTTCATTCCAAGATACTGAGCACTTGGGTGATGGGAATGAAAAG GCAATAGTGCGGTATAAGAGTTTGGAGTTTCCTGACTCCGGCTTTCTATCTTCTTCTGGC AGATCCAGTGATGATGTGCAAACCGACATTAGAATTGGTTATATACCAAATCAGGATCGT ATTCAACATTTTAGCAAATTGACAAGCTCAAAAGGTGCTGATCAAGAGAAGTTAAATTTA GAAAGCAAACAGCTAGTGAAATCAGGTGATAGGGAAAATTTTGTTGGCCTTACTCCGGAT TGTACTACATTGACAAGCACAAAACTGGCCGGTGAGAAAAAGATTGGTTTAGAAAGCCAA CAGTCTAGGCAATCAGGTAGAGAAGACATTTCTCATGGCCATGTTCAGAATTCAGTTGCA TTGACCAGCTCGAAAGTGGCCAATAGGGGGAAGATTGATTTAGAAAGTCACCAGCTTGTG AAACTTGGTAACCAAGAAAGTCCCCGGGGAAACAAAGTACCACTGCCTCTTGGACCCCCT TTACCAAAATCTCCATCAGAGTCTTGGCTAAAGCGTACCTTACCTAGTATTTCCTCCAGG AGTTCATCTTCACAGTCTTCTCTTGGTTCACGGAGTTATACTAGCAGTCAGGCTTCCAAG ACATCCTCTCTTGATCCCAAGTGGGAGACAATTGTTAAAACTTCTAAACCGCACCATGGA CATTTGCGGTTTTCAGAGGAGCTTCTGACACCTATACCGGAAGCTTAG
PEP MMLKNLMEEKQLNFNQPLLSVRRFSATVVSSEADEKRKTEKSLPKLPPLPVYKSELKSGP VRNPGTVPFVWEQIPGRPKDERKSPNQALEWLPTAPKLPPGRVSKVKKQATDKGSKCTTA AQSPTGNVLSNSQNVSTLDTKEATKYDSSKVEMEEKGIAGSDDGDETYLDALSRSESFFM NCSVSGLSGLDGLDIKPSGTFSTDPQTRDFMMGRFLPAAKAMASETPQYASRKQPVAREQ PLLQEQPSGMKKVVSLDKQLPLNQHRPKDLPHYVQDIAGDKSEDEGMRVQAQLPISSVRR VRAKSSYAISYREAKKEGRIIDYRGNGFEIREKSDKVEEITHSVESSFQDTEHLGDGNEK AIVRYKSLEFPDSGFLSSSGRSSDDVQTDIRIGYIPNQDRIQHFSKLTSSKGADQEKLNL ESKQLVKSGDRENFVGLTPDCTTLTSTKLAGEKKIGLESQQSRQSGREDISHGHVQNSVA LTSSKVANRGKIDLESHQLVKLGNQESPRGNKVPLPLGPPLPKSPSESWLKRTLPSISSR SSSSQSSLGSRSYTSSQASKTSSLDPKWETIVKTSKPHHGHLRFSEELLTPIPEA


| Top |