Cherry SNP DataBase

Gene information

Gene Pav_sc0000071.1_g440.1.mk
Chromosome name PAV_r1.0chr7
start 11820360
end 11824606
PAV_r1.0 name Pav_sc0000071.1
start 174086
end 178332
direction +
Annotation NR PREDICTED: putative F-box/LRR-repeat protein At5g02930
Sequence CDS ATGAAAAGAGTGCGTGGGATATCAGATGAAACCTCCAACGACAATGGCAAGGATCGTATT AGTTCGTTGCCCAATGATGTTCTTTGTTCAATTGTTGACCTGCTAAGTATAAGGGATGCT ATACACACTAGCACGTTATCACGCAGGTGGAAGAACATTTATGCACACAAGTCAACATTG GAATTTGATTGGCGAGACATCATTTCGAATGATGCGAACACATATACTCGTGGAAACGTT GCCATTAGGAATGTAAGAAATTTCCAAAGAAGCATTGAAGCAATCTTAGCTTCATACTTG GGCACCAATCTTGAATCTTTCAAGGTTCAATGTTGCTTTGGAAACGAGCATCCTCGTTAC TTCAAAGGCTGGATCAATTTTGCTATAGCAAAGGGGGTTAAAAACCTTGAGCTTGCCTTC AGTTGTGATGAATTATCCGAGCGCACGGATTGGAGAGACATTGACTACTATAACTTTCCT ACTCAGCTGCTTCCGAGTGGTGAAGGATCAAATCTGAGGCATCTCTCCCTACGTACATGC AAGCTGAGGCTAGATAATATATTCACTGATCGATTTAGCAAACTCACGAGTCTAGTTTTG TGTGATGTCAAGTTCGTTGGAAGAGTAGAACCTAGCATGTTTTCTTCTTGTTCGAAGCTT GAGTCTTTGACATTGGAACGGTGCTATGGTTTCGAAAGCTTGCACTTTGACAAACTTGAT TGTTTGAAAATGTTGGTGGTGAGGAGATGTGAAGGGTTGAGATTGATTCGCCTAATTAGT GTCATCAATCTTACCTCTTTTCATTGTATTGGAGACCACGCAGAACTACAATTAAGATTG GGAAGGGTTCCCAATCTGAAGGATGTCCATTTAATGCTGAAGCAGATTAATGTGCGTAGT TTTTATGCCTGGTTGGAGAAACTTATTAATCCTCATTACCACACTCTAAAGCTGGTTGGA GATGTAGAGCCGCGTGCGTGTGTTTCTTCTTGGTCCAACGTTGAGTCTTTGACATTGGAA TGGTGCTTTGGACAAGAAAGATTGTGCTTTGAAGACTGGATTGAAACCATGAAAAGAGTG TGTGGAATATCAGCTGACACCTCCAACCACAATGACAAGGATCACATTAGTGCATTGCCT GATGATGTTCTTCATACAATTGTTAACTTGCTGAGTATGAGAGATGCGATACGCACTAGC AAGTTATCACGAAGGTGGAAGAACATTTATGCACACAAGTCAAGACTGGAATTTGATTGG CGTGACATAATTTCGAATGACGCAAACACATATACTCGTAGAATGGTTTCCATTAGGAAT GTGAGATATTTCCAAAGAAGCATAGAAGCAATCTTAGCTTCACATTCGGGTACCAAGATT GAATACTTCAAGCAAGGGCTGCAGAAACCCTTGAGCTTGCCTTCAGTTGTGACGAATTAT CGGAGCGTACTGATTGGACAACAATTGACTGTTATAACTTTCCTACACATGTCTGCTTCC GATCAGTGGCGAAGGATCAAAACTGAGGCATCTCTCCTTAGCACACTCACGAACCTTGTT TTGTGTGATGTTAAGTTTGTTGGAGAAGTAGAGCCTCGTCTGTTTTCTTCTTGCTCGAAG CTCGAGTCTTTGACACTGGAAAGGTGCTTTAGTTTTGAAAGCTTGCGCTTCGACCCACAT GATTGTTTTGAAGACGCTGGTGGTGAGGAGTTAAAATGGATTGGCCTAATTAGGGTAACC AATCTTACCACTTTTCATTTTATGGGAGACGATATTGACGACGTACTCAAATCATCTTAT CTTCTTGACACGTCG
PEP MKRVRGISDETSNDNGKDRISSLPNDVLCSIVDLLSIRDAIHTSTLSRRWKNIYAHKSTL EFDWRDIISNDANTYTRGNVAIRNVRNFQRSIEAILASYLGTNLESFKVQCCFGNEHPRY FKGWINFAIAKGVKNLELAFSCDELSERTDWRDIDYYNFPTQLLPSGEGSNLRHLSLRTC KLRLDNIFTDRFSKLTSLVLCDVKFVGRVEPSMFSSCSKLESLTLERCYGFESLHFDKLD CLKMLVVRRCEGLRLIRLISVINLTSFHCIGDHAELQLRLGRVPNLKDVHLMLKQINVRS FYAWLEKLINPHYHTLKLVGDVEPRACVSSWSNVESLTLEWCFGQERLCFEDWIETMKRV CGISADTSNHNDKDHISALPDDVLHTIVNLLSMRDAIRTSKLSRRWKNIYAHKSRLEFDW RDIISNDANTYTRRMVSIRNVRYFQRSIEAILASHSGTKIEYFKQGLQKPLSLPSVVTNY RSVLIGQQLTVITFLHMSASDQWRRIKTEASLLSTLTNLVLCDVKFVGEVEPRLFSSCSK LESLTLERCFSFESLRFDPHDCFEDAGGEELKWIGLIRVTNLTTFHFMGDDIDDVLKSSY LLDTS


| Top |