Cherry SNP DataBase

Gene information

Gene Pav_sc0000071.1_g780.1.mk
Chromosome name PAV_r1.0chr7
start 12023946
end 12026982
PAV_r1.0 name Pav_sc0000071.1
start 377672
end 380708
direction +
Annotation NR PREDICTED: eukaryotic initiation factor 4A isoform X1
Sequence CDS ATGGCGGTGGATGCCATTGAAACCCCTTCTCCTCCCTTTCACCCCCCTTCTTCCCATTTC AGTCAACAAAGCCACTTCTATCTCGCCGTTGACAGGCTCCAGTTCAAGATGGAGACATTG ATGGACCTGTTGGGCGTGGCGGGTAGACGTCCCTGCCTACCTATAGTGGTCTGCTGCAGC TCACGTGATGAGCTCGACGCCGTCAGCTCCGCCGTCGCCAACGTCCCCTATATCTCTTTA GCTTCTCTGTACACTGACCTCGCTGAAGCAGACCGTTCTTTGATATTAGAGCGCTTTCGG GAAGCAACAATGAGGTGGAACCCAGAAGCCAGTGCTCAACCAGCGGATGACAATGAGCCT GTGAAAGATGAACAAAAATCTCATATGATAGTTGCAACAGATGCATGCCTTCCACTTCTT GCTTCCGGGGAGTCGCCCATTTCTGCTCATGTTCTTATAAATTATGAGTTGCCTACAAAG AAGGAAACATATATGAGGCGGTTGACAACTTGTTTGGCTGCAGATGGGATTGTAATCAAT ATGGTTGTTGGGGGTGAGGTAGTAACTCTCAAAAGCATTGAAGAAAGTAGCAACCTGGTC ATAGCTGAGATGCCCATAAATATTTCTGAGATTTTATGA
PEP MAVDAIETPSPPFHPPSSHFSQQSHFYLAVDRLQFKMETLMDLLGVAGRRPCLPIVVCCS SRDELDAVSSAVANVPYISLASLYTDLAEADRSLILERFREATMRWNPEASAQPADDNEP VKDEQKSHMIVATDACLPLLASGESPISAHVLINYELPTKKETYMRRLTTCLAADGIVIN MVVGGEVVTLKSIEESSNLVIAEMPINISEIL


| Top |