Cherry SNP DataBase

Gene information

Gene Pav_sc0000072.1_g140.1.mk
Chromosome name PAV_r1.0chr2
start 13776572
end 13778497
PAV_r1.0 name Pav_sc0000072.1
start 65973
end 67898
direction +
Annotation NR PREDICTED: uncharacterized protein LOC103331798
Sequence CDS ATGAATCCTCACAAGACAGAAGATCTCTTCCACCATCATTTCCATCACCACCATCACCAC CATGATCTGGGCCCACCACCTTCCCAGATCATGCAATCTCCGCCGTCCATTTCCCTCAAC CCCGACGACGTCGTCCTCGACGACCCCGTCTTCCCCCCTCTCCCCGAAATCGAACTCTTC CGCTCATCCTCCTCCTCCCCTTCTCACTCCTCCGACGAAAACGACGACGTCCCAAACCCT AACCCCAACCGCCCCGACCCCAACTCCGACCCGAAATCCCAACCCTTTTACATCTCCCCG GAGCCCCACATCTCGACCCAGTTCTACACCTTCAACCCGGAGTCCCATTCCCTCATGATC AAGTGCCTTCTCGAGGCCCGCCTCGCCACCCCGGCCGAGATCCGGGCCGCCACGCCCCGA CCTGTTCTCAAGTCCTGGAGGGTCGTCTGGAAGGACCGCAACGAGGACACCGCTTACGTC ACCGCATGGAAGCGCATCCAGGACAAGCTCGCCGCCCATGTCGACCAAAACGGTAACGAA TTCTTGTGTTTCAAGAACAACAACCAGCAATTCGTTTCGCACATTAATCAGTGGCAGGAC ATTGTTATGAGTTTTCATAGCGACACTGACTTGAAACACTTGGCGTTGAAGGAAACCATT GATAGGATTAAGCAGGTTTGGACTGTAGGTGCTAAGTTTTATGGCATTCCTGAGAGTTAC ATTAGGGTTTGTGTTGCTGCTTGCCCTGTGTGCTCCTCGGAGAATTCGGGCCTCTCCGGG AGGAGCAAAAGGCGGCGTTTTGAGTATACTGAGTCCTTTGATGTGCCTGCTAAAGAGGTG CCCACTAGGCTTCAGCAATTGGCTGCTAAGCATAAGGTGGTGTTGTGTATAAGGCAGAAG TATATTAGGTATAAGCCCTTTATGGCTGAGGTTAAGGACTATGCTTGTCATAGGGCAGGG GAGCCTGCAGCTAAGAAGTCAAAGATTTTGAAGAGGGAGCCCTATGCTTCTAAAAGGTGT GGCTGCGGCTTTCGAATTAGGGCCATTGTTCCAATTGCGAATTACAATGAGAAGGACAAG ACTTTTGTGTATCAGGAAGAGGGGATGGCGGTGTTTAAGCTGTATGCTGTGCACTCGGGG CATGAGCCAGGTCCGTTGGATGGGAATGCAAGGATTATGCATCGGCTGAGGGCAGACTGT AGGAGTCCGAAGGATCTGATAGGTGACCCTTGCAAGCCAGAAAAGTGGTTGAGATGCAGT GACTTTGATGAGAAGAGCATCCTTAATTGCGAGGATACTAAACTAACCAAGTCCTTAAGA CATGATGAGGGTATAGCAGGAGATGTAGGTCTTGTTGGTATACAGGTTGATAGCTTCTAT CAAGGGAGTTCTAAATGGTTTGATTCTCCTTGTGGATTGGACCCAGGTGCAGATTGTGGG GATAGTGCATTCAGGAACGGGGAGATTGTTTAG
PEP MNPHKTEDLFHHHFHHHHHHHDLGPPPSQIMQSPPSISLNPDDVVLDDPVFPPLPEIELF RSSSSSPSHSSDENDDVPNPNPNRPDPNSDPKSQPFYISPEPHISTQFYTFNPESHSLMI KCLLEARLATPAEIRAATPRPVLKSWRVVWKDRNEDTAYVTAWKRIQDKLAAHVDQNGNE FLCFKNNNQQFVSHINQWQDIVMSFHSDTDLKHLALKETIDRIKQVWTVGAKFYGIPESY IRVCVAACPVCSSENSGLSGRSKRRRFEYTESFDVPAKEVPTRLQQLAAKHKVVLCIRQK YIRYKPFMAEVKDYACHRAGEPAAKKSKILKREPYASKRCGCGFRIRAIVPIANYNEKDK TFVYQEEGMAVFKLYAVHSGHEPGPLDGNARIMHRLRADCRSPKDLIGDPCKPEKWLRCS DFDEKSILNCEDTKLTKSLRHDEGIAGDVGLVGIQVDSFYQGSSKWFDSPCGLDPGADCG DSAFRNGEIV


| Top |