Cherry SNP DataBase

Gene information

Gene Pav_sc0000084.1_g400.1.mk
Chromosome name PAV_r1.0chr2
start 18572462
end 18582269
PAV_r1.0 name Pav_sc0000084.1
start 215851
end 225658
direction +
Annotation NR PREDICTED: endoplasmic reticulum metallopeptidase 1
Sequence CDS ATGCGACGGAGGCCCCAGAGCACGTCAGCAGCGACCACCAAACCAGAAGTGAGTGAAGAA CCAATTGCCCCTTCATGGGTTGCACAGAGGCCTCAGAGATCACCCTTTGTTTGGCTCACC TTGTTCTTGGCCATCGCCTACGGCTCTTGGGGTGTTTTTCATTACCAGTTCGAGAGCCTG CCTACGCCTCTGACAGCTGAGCAGGCAGGAAAGAGAGGCTTTTCTGAGTTTTCTGCACTG GAACACGTCAAGGCGTTGACCCAATTGGGTCCTCACTCTGTTGGCTCTGATGCTCTTCAT CTAGCTCTCCAGTATGTTTTGGCAGAAGCTGAGAAGATCAAGAAAACTGCTCACTGGGAG GTTGATGTCGAAGTGGACTCGTTCACTGCCAAATCAGGAGCAAATCGTATGGCTGGTGGC TTGTTTAAGGGCAGAACACTTGTTTATTCGGATCTAAATCACATAATTATAAGAATTTTG CCAAAGTATGCACCGGAAGCAGTAGATAATGCCATTCTGGTATCTTCTCACATTGACACT GTCTTCTCAACGGGAGGGGCTGGAGATTGCAGTTCTTGTGTAGCTGTCATGTTGGAACTT GCTCGTGGAATTTCCCAGTGGGCTCATGGATTTAAGCATGCTCATCCATGGAGTAAATCG ATTCGTCTGGCTATTGATTTGGAGGCCATGGGTATTGGAGGGAAGTCTGGCATATTTCAG GCTGGTCCTGATCCTTGGCCTATCGAGACTTTTGCCGCAGTAGCAAAATACCCATCTGGC CAAATTTTAGCACAGGATATATTTTCTTCTGGAGCCATAAAATCTGCAACAGATTTCCAA GTATACAGAGAGGTTGCTGGTCTTTCAGGGCTTGACTTTGCTTACGCTGATAATACTGCA GTATACCATACAAAGAATGACAAATTAGAGCTTCTTAAATTAGGATCTCTTCAACATCTT GGAGAAAATATGCTTGCTTTTCTGCTTAAGATTGCTGCATCCTCTCATCTTCCAAAAGTC AATACAATGGTAGAAGAGGATAATAAGGGCCAGAGCACTGCTGTATATTTTGACATTTTG GGAACGTATATGGTTGTCTATCGCCAACGCTTTGCAAATATGCTTCATAAGTCAGTGATA GCTCAATCACTTCTAATATGGACTACATCGTTGCTTATGGGTGGTTATCCTGCTGCAATT TCATTGGCCTTGTCATGTTTGAGTGTTATCCTTATGTGGATATTTGCATTGAGTTTCTCT GTTCTTGCTGCTTTCATTATACCCCTAATATCTTCTTCACCAGTGCCATATGTTGCAAAC CCATGGCTGGTAGTCGGGTTATTTGCCGCTCCTGCTCTTCTTGGGGCATTAACCGGTCAA TATTTGGGTTATCTTGTTCTGCACACGCATTTGTCAAATGTATACGCCAAGAAGAAACAG ATCTCACCTGTTATTCAAGCTGATTTGATTAAATCAGAGGCTGAAAGATGGCTCTATAAA TCTGGATCTCTTCAGTGGCTCATTCTCCTCATTTTGGGAACCTATTACAAAATTGGATCG TCTTATTTGGCTCTTTTTTGGTTGGTTCCACCAGCATTCGCATATGGCTTTCTTGAGGCG ACTCTAACTCCAGCTCGATTTCCCAAGCCACTCAAACTTGCAACCCTGCTGATAGGATTA GCTGTACCAATATTAATTTCTGCTGGCGGATTTATTCGGCTGGCTGGAACGATAATTGGG ACTGTGGTTCGACTTGACAGGAACCCAGGTGGCACTCCTGACTGGCTGGGGAATGTTATA GTTGCCATTTATGTTGCTGCTGTCATGTGCCTGACTTTGGTCTATCTCCTTTCATATATT CATCTTCCAGGTGCCAAGAAATCAATTGTGCTTTCAACTTGCTTGCTGTTTGGCCTCTCA CTTGCTGTTGTATCATTGGGTATCGTTCCACCATTTACCAAAGACACATCCAGAGCTGTA AATGTTGTTCATGTTGTAGATATGACAAGAAGCTTCGATGAAAAACAAGATCCTAGATCA TATGTGTCTCTGTTTTCTTCTACCCCCGGGAAATTGACAAAGGAGGTTGAGCAAATCAAT GAAGGTTTCAGATGCGGTAGAGATAAAGTTGTTGATCTGGTAACATTTTCAGTCAAATAC AGTTGCTGGACCTTTGATGACACTGACAGTGGGTGGAGTGAATCAGATGTTCCCATAATG CACGTCGATAGCGATACTCGTGGTGGTGAAAGAATAACACAAGTTTTAATTGATACAAAA GGTTCGACACGATGGACTCTTGCTATCAATGCTGATGAAATAGAAGATTTCACATTCGAA GATGCAGGAAGCTCAGAGGAATTGGTTTTGGATGGTGACATGAGCAGTGTAGATGGGTGG CACATTATGCAGTTTTCCGGGGGAAAGAATGCACCGACGAAGTTCGGTCTGACACTCTTC TGGATGAAAAACTCTACTCGGTTGGATCACAAGGTGGAAGGGAAGAGAGAGGAGGGCACT CCCCTTCTAAAGTTAAGAACTGATATGGACATAGTAACTCCTAAAGTTGACAGAGTTCTT TCTAAGCTTCCTCCTTGGTGTTCACTGTTCGGCAAGTCCACGTCCCCCACCACCTTTTCA TTTTTAAGTAACCTTCCTAAAGAATCTGCGATTGCTGATAGGGAGAGAGACACAAAACAC AGAGTCCAAGAAATGCGGACCATACCGTTGGGAATATCAGTATCCACAACCTCCATAAAC AGCTCCTCCAAAACCACCTTTCTCAATAGTCTCAACCTAAAGAGACCAAACCCACTTCCT CTTACTTCTACTTCTACTTCTTCTAGGGTTCCTGCCTCCACCTCCACTGAGGATGATGAT TTCTCTTTTCTTTCCTTCTCCAAATCTGGAGTATGCAGAGCCAGTCAAGTGGCTGATTTA TTTCCAACAGTGTCTCCCGAGATTGTTGTCCGGGAGGCCAGGTTAGAGGACTGTTGGGAG GTGGCTGAGACTCACTGCAGCTCTTTCTTCCCTGAATATTCTTTCCCTTTAGATTTTGTT CTGCGGATTGACCGGCTGGTAGCGATGCTAGCCGGATTTTCTTTGCCAAATGGTTGCAAA AGGACTTGTCTCGTTGCTGTCATTGGCAACTCTGTTGATGAGACTTTTCTCTTTGGGAGT GAAGATTTCAAGATTGGTGGTTTTGATGGGAAGTTCAGTCTCAATAGGAGGTATGTGGCT GGGATATTGACAGTGGATACTGTTGCTGATTTTCTTCCTAGAAAAGGACCTCTCCGGCAA AGAAGGACTGGAGTTGCATACGTATCAAATGTTGCTGTCCGGGAGAGATTTCGACGAAGA GGCATAGCTAAGAGGCTAATAGCAAAGGCAGAAGCTCAAGCCAGGAGCTGGGATTGCCGT GCCATTGCGTTGCACTGTGACTTAAACAATCCTGGGGCTATAAAGCTGTACAAAGGCCAG GGTTTCAGAAGCATTAAGGTGCCTGAAGGAGCAAACTGGCCCCAGCCAAAGACTGCTCCG GATGTTAGGTTCAACTTCATGATGAAGCTTCTGAACACCAAGGCTGCTACTTAG
PEP MRRRPQSTSAATTKPEVSEEPIAPSWVAQRPQRSPFVWLTLFLAIAYGSWGVFHYQFESL PTPLTAEQAGKRGFSEFSALEHVKALTQLGPHSVGSDALHLALQYVLAEAEKIKKTAHWE VDVEVDSFTAKSGANRMAGGLFKGRTLVYSDLNHIIIRILPKYAPEAVDNAILVSSHIDT VFSTGGAGDCSSCVAVMLELARGISQWAHGFKHAHPWSKSIRLAIDLEAMGIGGKSGIFQ AGPDPWPIETFAAVAKYPSGQILAQDIFSSGAIKSATDFQVYREVAGLSGLDFAYADNTA VYHTKNDKLELLKLGSLQHLGENMLAFLLKIAASSHLPKVNTMVEEDNKGQSTAVYFDIL GTYMVVYRQRFANMLHKSVIAQSLLIWTTSLLMGGYPAAISLALSCLSVILMWIFALSFS VLAAFIIPLISSSPVPYVANPWLVVGLFAAPALLGALTGQYLGYLVLHTHLSNVYAKKKQ ISPVIQADLIKSEAERWLYKSGSLQWLILLILGTYYKIGSSYLALFWLVPPAFAYGFLEA TLTPARFPKPLKLATLLIGLAVPILISAGGFIRLAGTIIGTVVRLDRNPGGTPDWLGNVI VAIYVAAVMCLTLVYLLSYIHLPGAKKSIVLSTCLLFGLSLAVVSLGIVPPFTKDTSRAV NVVHVVDMTRSFDEKQDPRSYVSLFSSTPGKLTKEVEQINEGFRCGRDKVVDLVTFSVKY SCWTFDDTDSGWSESDVPIMHVDSDTRGGERITQVLIDTKGSTRWTLAINADEIEDFTFE DAGSSEELVLDGDMSSVDGWHIMQFSGGKNAPTKFGLTLFWMKNSTRLDHKVEGKREEGT PLLKLRTDMDIVTPKVDRVLSKLPPWCSLFGKSTSPTTFSFLSNLPKESAIADRERDTKH RVQEMRTIPLGISVSTTSINSSSKTTFLNSLNLKRPNPLPLTSTSTSSRVPASTSTEDDD FSFLSFSKSGVCRASQVADLFPTVSPEIVVREARLEDCWEVAETHCSSFFPEYSFPLDFV LRIDRLVAMLAGFSLPNGCKRTCLVAVIGNSVDETFLFGSEDFKIGGFDGKFSLNRRYVA GILTVDTVADFLPRKGPLRQRRTGVAYVSNVAVRERFRRRGIAKRLIAKAEAQARSWDCR AIALHCDLNNPGAIKLYKGQGFRSIKVPEGANWPQPKTAPDVRFNFMMKLLNTKAAT


| Top |