Cherry SNP DataBase

Gene information

Gene Pav_sc0000085.1_g130.1.mk
Chromosome name PAV_r1.0chr1
start 27740385
end 27742865
PAV_r1.0 name Pav_sc0000085.1
start 39526
end 42006
direction +
Annotation NR hypothetical protein PRUPE_ppa009562mg
Sequence CDS ATGCACAGAATCTTCATGTTATTACACACAGCTTGGGTGTTGTTGGTGGTCTTTGTTTTG AAGGGATGTGCACAAAACTTACCCCCTGCAAAATACGATGGGTTCGTGTACGGCCATCAC CGAGTTGACTCGGATTCGATCCTGATTGAAGCGTTCTTCGACCCGGTGTGCCCAGACAGT AGGGACGCCTGGCCACCCCTCAAACAAGCCCTCCGGCACTACGCTCCTCGCATTTCGGTG GTGGTTCACCTGTTACCGTTGCCTTACCATGACAATGCTTTTGTTAGCTCTCGTGTACTA CACATCGTAAATCAGCTGAACGCTTCTGCTACATTCCCATTGTTGGAGTGGTTCTTCAAG AATCAGGAGAAGTATTATAATGCACAAACTCGCAACCTTTCCAGAGTTGCAGTTGCAAAT GACATTGTCAACTCTGTCACAGAAGTAGTTGGGAACTCCTATCATAGTGACCTTGAATCC GGCCTCAATGACCGGAAAACGGATCTCAAAACTAGGGTTTCCTTCAAGTATAGCGCTTCA AGAGGGGTGTATGCAACGCCAACTTTCTTTATAAATGGATTTGTATTGCCTGATGCTGGC TCCCCTACAGATTTTAATGGATGGAAAAAAACCATTGACCCATTAGTTGGCAATGAGGTG CCAAAGAACCAGGAAAATCTGCACTTCTTCTTGTGA
PEP MHRIFMLLHTAWVLLVVFVLKGCAQNLPPAKYDGFVYGHHRVDSDSILIEAFFDPVCPDS RDAWPPLKQALRHYAPRISVVVHLLPLPYHDNAFVSSRVLHIVNQLNASATFPLLEWFFK NQEKYYNAQTRNLSRVAVANDIVNSVTEVVGNSYHSDLESGLNDRKTDLKTRVSFKYSAS RGVYATPTFFINGFVLPDAGSPTDFNGWKKTIDPLVGNEVPKNQENLHFFL


| Top |