Cherry SNP DataBase

Gene information

Gene Pav_sc0000091.1_g350.1.mk
Chromosome name PAV_r1.0chr1
start 18230101
end 18234634
PAV_r1.0 name Pav_sc0000091.1
start 181215
end 185748
direction +
Annotation NR PREDICTED: squamosa promoter-binding-like protein 2
Sequence CDS ATGAATTCTGTGTTGCTGATGGAGTGGAATGAAAAACCTCCTTCACTATGGGATTTGGAG AACCTTTTCATGTTTGGTGCAAAAGTAACTGACAATTCCAAGAAGTTACAACCAGCAGAC TGGGGTATTGAAGGGGAACGAGGAATGAACTCTGAATCTTTCTATTCAACTGGGGGTGAT GGGGGCAGTGGTGTTTCTGGCTCTGATTTAGGAGATGGCTCATCAAAAAGTTCAAAATCA GCTTCCGTCAGTTCTTCAGTTGGGGAAAGTAAGAAACCCAATTTCAACCTTGATGCTTTT GAAGGTTTCCCGAATGATTTCATTCATAAAAATGAATCAGCTAAAGCTGAGGCCCTTGGA TCTTCTCCAACTCATGAGGTTTCAGCTGGGTCGGGTGAGCCACTGCTCAGTCTAAAGCTT GGTAAGCGGATGTACTTTGAAGATGTTTGTGCAGGAAATAATCCTAAATCCTCTTCCCTT TCTGTTAAATCCTCGTCAATGGCAAAGACAAAGAGGAGTAAGTCCACTGGTCAGAGTGCA TTTGCACCACACTGCCAAGTTGAAGGCTGCAATATTGATCTGTCCTCAGCCAAAGATTAC CACCGTAAACATAGGATTTGTGCTAATCATTCGAAATCTCCGAAGGTCGTTGTAGATGGG GTGGAACGTCGGTTTTGCCAGCAGTGTAGCAGGATGGAGCTAACTGCTTTTGATTTAAAC AATGAGAGGCAACAGATGAGCCTTGTTTTGGACCAAGCCCGAAGTGTTTACACAAGGCAT CCCTCAAACTTAACATGGGATGGCGCATGCAGCTTCAAGTTTGGACAAACGAAAGAATAT TTTCCAAAGCCTGCAAAAGGAGGAGGCACTGGCGGGCAGCTGAATTTGGCCAACAATGGA ATACCAAGTTCAATAACAATGCTGTACCATGATTCCAGTAGGCTGTCACCTTCGAAGGGC ACTGCCACTGAGGTTCTCAACCGAGGTGCTGAAGAATCTATGATCTCTTTCAACCTGGGT GCAACACAGGATTTTCATCGTGCTCTCTCTCTTCTGTCAACAAGTTCGTGGGTTTCAGGC GAGGCGAAACCTGTTGCACTTGATAATAATACCAACCAAAATTATCAGAACATCCCTCAA CCTGGGATGCAAGCGATGACCCAAGGTTTGCCAGTCTCATCAGAGTACTGGCAAACTCAA CATCTATCCCTTAATACCCAAGAAGCACATGTCTCCCACTCACACAGTAACGGCAGCAAC CACTTCCAACAGGATCTTCATCAGTTCAAAGGGCCCTATGAGTTTGGTTATCAGACCAAC CAATTCAATTAA
PEP MNSVLLMEWNEKPPSLWDLENLFMFGAKVTDNSKKLQPADWGIEGERGMNSESFYSTGGD GGSGVSGSDLGDGSSKSSKSASVSSSVGESKKPNFNLDAFEGFPNDFIHKNESAKAEALG SSPTHEVSAGSGEPLLSLKLGKRMYFEDVCAGNNPKSSSLSVKSSSMAKTKRSKSTGQSA FAPHCQVEGCNIDLSSAKDYHRKHRICANHSKSPKVVVDGVERRFCQQCSRMELTAFDLN NERQQMSLVLDQARSVYTRHPSNLTWDGACSFKFGQTKEYFPKPAKGGGTGGQLNLANNG IPSSITMLYHDSSRLSPSKGTATEVLNRGAEESMISFNLGATQDFHRALSLLSTSSWVSG EAKPVALDNNTNQNYQNIPQPGMQAMTQGLPVSSEYWQTQHLSLNTQEAHVSHSHSNGSN HFQQDLHQFKGPYEFGYQTNQFN


| Top |