Cherry SNP DataBase

Gene information

Gene Pav_sc0000094.1_g160.1.mk
Chromosome name PAV_r1.0chr6
start 6751400
end 6752217
PAV_r1.0 name Pav_sc0000094.1
start 85165
end 85982
direction -
Annotation NR hypothetical protein PRUPE_ppa014126mg
Sequence CDS ATGAAAGTTGAAGAATATAGGAAGCCATTGAGTTTAGAATCTCTTTTGGTTAGGCAATAT TTCCAGAGCAGGAACTTTTCAAGTGAGATTAGAGAGCCGATATTTGGAAGCAAATCTCGT GCAGAGTTTGCGCATCTTTGGAACAAAGCTGTGGACCAGACATTTCGACCTGTGATTGAG TCTCTTAGTTCATCTGGATGGTAG
PEP MKVEEYRKPLSLESLLVRQYFQSRNFSSEIREPIFGSKSRAEFAHLWNKAVDQTFRPVIE SLSSSGW


| Top |