Cherry SNP DataBase

Gene information

Gene Pav_sc0000094.1_g170.1.mk
Chromosome name PAV_r1.0chr6
start 6741620
end 6746581
PAV_r1.0 name Pav_sc0000094.1
start 90801
end 95762
direction +
Annotation NR PREDICTED: probable serine/threonine-protein kinase NAK
Sequence CDS ATGCGCTTGTTCTGGTGGCAACAGCTGCCTCTGCTTTTACTGATCCAACTTTTGGAACCC GGCAGAACAGGCTACAAAATATATGCTGAAGCTCTACAAACTTTCAAGAGCAGAGTTGGA GGTCCTCAACTATTCAATGGTCAAATCCGAAGATATCCATGTCTAAGACAATGGAAAATT GTCAACTGCCATAAGGACCGGTTTTCTGGTATCCATTCAGTTCCTCGGCGGGCTAACACA GTCAATTTGTCCCCATTTTCTCCAAGACTTGTTGTTGCACACTCTTCAATTCAATTACAA AAAGAGCTCCATAAACCAAGAAACAGGAGGATAGCAGCCATAGTTGATGGGGATAATGGT GCTCCAACACTCACACCTGTGCAAGAAGCACGTGGTAACAATCTAAGAAAACAGAAAGTT GCAGCACTTATTGGTGGAGTTGCTGCAGCTCTGCTTGTGGTTATCATAGTGGTGATTGTT TACATCTGTTTGATGCGTGTGAAAAGATTCATTAGACGAACATCTGAAACAGAGTCATCC GTACCATCACCTCCTGTTGAATGGGAAAGAAGGAATATGTCTCCCTACGCCGTTGCTCTC TCTGTGTATAATACACAGAACTTGAGACAACTCACCATATTGGAACTGGAACAAGCGACA TGCAATTTCAATGAAATTAATATCATAGGCCAATGTAGATTTGGTTTGGTCTACAAGGGA TTGCTGCAAGATGGATCTATTGTAGCTATCAAGAGACGTCTACATGCCCCAACTCAGTAC TTCTTTCATGAGGTGAAGCGCATAGCTCATGTCAACCACGTGCATATTCTCAGGCTTATT GGTTATTGTCAAGATGCTAGTCAACAGTTACTTGTCTATGAATATTTTCCCAATGGGAAT GTTGGAAATCATCTTTATGATGCCGAAGGTTTACCTATTGGAAAGTTGGGCATAAGACAA AGGTTATCGATTGCTTTGGGAGCAGCTAAAGGACTTGCGCATCTTCACAATTTGGTGCCT CCTCTCCTGCACATGTATTTCAGGACAAGCAATGTTCTACTGGATGAAAACTTTACTGCC AAGGTGTCTGATTATGGACTAACCAAATTGCTAGTTAAGGGTCATCATGCCGGATCATCT TCCACCATAGATTACTTTCTTGACCCGGAGTATGTAATCTCTCTCACTAAAGCGAAGGGT TGCAATGATTTGGGCAGATTTGTTGATAGAACATTAGGTGACAACTCAATGCAAGCTGCA AAGCAAATGATGGAGTTGGCATTGATGTGCATAGATGCTAGTCAGCAAAGGCTGCAAATG CAGATTGTCGTTGAAGAGCTAGAAAGAATTCATCGAGCGAGCGAAATTAGCCACTTTCAT GTAGAAGTTGATGAGGCGATAGGTGCTGTGACTCTTGGGAGTGAGCTTTTCAAATGA
PEP MRLFWWQQLPLLLLIQLLEPGRTGYKIYAEALQTFKSRVGGPQLFNGQIRRYPCLRQWKI VNCHKDRFSGIHSVPRRANTVNLSPFSPRLVVAHSSIQLQKELHKPRNRRIAAIVDGDNG APTLTPVQEARGNNLRKQKVAALIGGVAAALLVVIIVVIVYICLMRVKRFIRRTSETESS VPSPPVEWERRNMSPYAVALSVYNTQNLRQLTILELEQATCNFNEINIIGQCRFGLVYKG LLQDGSIVAIKRRLHAPTQYFFHEVKRIAHVNHVHILRLIGYCQDASQQLLVYEYFPNGN VGNHLYDAEGLPIGKLGIRQRLSIALGAAKGLAHLHNLVPPLLHMYFRTSNVLLDENFTA KVSDYGLTKLLVKGHHAGSSSTIDYFLDPEYVISLTKAKGCNDLGRFVDRTLGDNSMQAA KQMMELALMCIDASQQRLQMQIVVEELERIHRASEISHFHVEVDEAIGAVTLGSELFK


| Top |