Cherry SNP DataBase

Gene information

Gene Pav_sc0000095.1_g100.1.br
Chromosome name PAV_r1.0chr4
start 10481173
end 10482501
PAV_r1.0 name Pav_sc0000095.1
start 25983
end 27311
direction +
Annotation NR PREDICTED: BAHD acyltransferase At5g47980-like
Sequence CDS ATGACTTCAGAGATCAAGGTTGAAGTCACTCAGGAGGAAATAATTAGACCATCCTCTCCA ACTCCTCACCACCTCAGAAGTTCTAACCTTTCTGTTTTTGATCAGCTTACTCCTCAAGTT TATGTCTCCGTACTTCTCTTCTACCCCAGCAATAACGGGGATAGCCATTCTTTGGCTGCT GAAAGGTCCAAGATTCTGAAAAGGTCATTATCCGAAGTCCTCACTCACTTCTATCCCTTT GCAGGAACAATCCAATCTAAGGATGTTTCAATCTGTTGCAATGACCATGGGGCTAAATTT TTTGAAGCCAGAGTCAACTGTCCCCTGTCACAGGTTTTTGATAAACCAGATCTTGGAATG CTAAAACAGTTGCATCCAAATGCAATAGAATCCGGGGCACAATCAGGCACAGGCCATCTT CTTCTGGTCCAAGCCAACTTTTTTGAATGTGGTGGGATGGCAATTGTAGTCAACATTTCA CATAAGCTCATTGATGCTTATACACTCTGCAAATTCATTAATAGCTGGTCTGCAATTTCC CTCTCCTCGGTCAGTACCGATCATGTAGTGCCTCCTGTAGAATTTGGTGCTGCAGCATCT CTTTTCCCACCTCTTGATTTCCTCAGTTCAACCCGAGCTTCTGTTGGCTTTGTCAAGTAC AATTGCATAACAAAGAGATTTGTGTTTGATGCCTCCAAGATTGCTACTCTCAAGCTTAAA GCTGCCAGTGCCACGGTGCCAAATCCAACGCGTGTTGAAGTAGTGTCAGCGCTCATCTGG AAATGTGCCATGGAAGCATCAAGTTCAAACTCGGGTGTCATAAGGCCATCCATATGGTGT CAATTTGTGAACATGAGGAAGATATTGCCGCAGTCCCCAGCAGAAAACTTATTGGGAAAT CTTGTGGGGTACTCTGTAGCAAAGACACAGGAAAGCGAAGTAGAACATGATCTTGGAAGC TTGGTTTTTAAATTGAGGAGGGGCTTTGAAGAACTTAAGGAAAAATATGGTAACGGAATT AGTAGTGAGGATGTGTTCCAACAGTTCAATGAGTTAGGGAAGCTCATTGGAAAGGTTGAT ATAGACAACTATTGTTTAACCAGTTGGTGCAGGTTTCCCTTTTATGAAGCTGATTTCGGA TGGGGAAAGCCATCATGGTTGAGTAATATCCCTAGCACGGCCGAACTCAAGAACATGATT TCATTGGTGGATGTAAGTGATGGCATTGGCATAGAAGCTCGCTTGACTTTGAAAGAAGAA GACATGGCCGTGATTGAAAGCAACGAGGAGCTGCTTGCATATGCTTCTCTGAATCCGTGT GTCGTGTAA
PEP MTSEIKVEVTQEEIIRPSSPTPHHLRSSNLSVFDQLTPQVYVSVLLFYPSNNGDSHSLAA ERSKILKRSLSEVLTHFYPFAGTIQSKDVSICCNDHGAKFFEARVNCPLSQVFDKPDLGM LKQLHPNAIESGAQSGTGHLLLVQANFFECGGMAIVVNISHKLIDAYTLCKFINSWSAIS LSSVSTDHVVPPVEFGAAASLFPPLDFLSSTRASVGFVKYNCITKRFVFDASKIATLKLK AASATVPNPTRVEVVSALIWKCAMEASSSNSGVIRPSIWCQFVNMRKILPQSPAENLLGN LVGYSVAKTQESEVEHDLGSLVFKLRRGFEELKEKYGNGISSEDVFQQFNELGKLIGKVD IDNYCLTSWCRFPFYEADFGWGKPSWLSNIPSTAELKNMISLVDVSDGIGIEARLTLKEE DMAVIESNEELLAYASLNPCVV


| Top |