Cherry SNP DataBase

Gene information

Gene Pav_sc0000095.1_g120.1.br
Chromosome name PAV_r1.0chr4
start 10486728
end 10488059
PAV_r1.0 name Pav_sc0000095.1
start 31538
end 32869
direction +
Annotation NR PREDICTED: BAHD acyltransferase At5g47980-like
Sequence CDS ATGACTTCAGAAATCAAGGTTGAAGTCATTCGGGAGGAAACAGTTAGACCATTTTCTCCA ACTCCTCACCACCTCAGGAGTTCTAACCTTTCTGTTTTTGATCAGCTTACTCCTCAAGTT TATGTCCCACTACTTCTCTTTTATCCCAGCAATAATAGTAATCACCATTCTGCGGCTTCG GCTTCTGAAAGATCCAAGCTTCTAAAAAGGACATTATCCGAAACCCTCAGTCACTTCTAT CCCTTTGCAGGAACAATCCAATCTAATGATGTTTCAATCTGTTGCAATGACCATGGGGCT ACATTTGTTGAAGCCAGAGTCAACTGTCCCATGTCAAAGATATCGGAGAAGCCAGATCTT GGGATACAAAAACAGTTGCATCCAAATGAATTAGAATTCATGGCACAATCAGGCACAGGC CATCTTCTACTAGTCCAAGCCAACTTCTTTGAATGTGGTGGGGTGGCAATTGGACTCAAC ATTTCACATAAGATCATTGATGCTTATACGCTCTGCAAATTCATTAATAGCTGGGCTGCA ATTTCCCTTGGCTCAGCCAATACTGACCATGTTGTGCCTCCTGTAGAATTTGGTGCTGCA GCATCTCTTTTCCCACCTCTGGATTTCCTCAATTCACCCCAACCTTCCATTGACTTTGTC AAGGAAAATTGCATAACAAGGAGATATGTGTTTGATGCCTCCAAGATTGCTGCTCTTAAG TCAAAAGCTGCCAGTGCTGCGGTGCCAAACCCAACTCGTGTTGAAGTAGTGTCAGCGCTC ATTTGGAAATGCGTAATGGAAGCATCAAGATCAAACTCAAATTTTGCAAGGCCATCTGTG TGGTGTCAATTTGTGAACATGAGGAAGATGTTGCCGCAGGCCCCAGGGGAAAACTTATTG GGAAATCTTGTGGGGTACTCTGTAGCAAAGACAGAGGAGAGGGAAGTAGAACATGATGTT AAAAGCTTGGTTTCTAAATTGAGGAAGGGCTTGGAAGAATTTAAGGAAAAATATGGTAAT GGAATTAGTAGGGAGGATGTGTTCCAACAGTGCATTGAGTTATCAAAGCTCGTTGGAAAG GTTGATATAGACACCTATTGTTCCACTAGTTGGTGTAGGTTTCCCTTCTATGAAGCCGAT TTTGGATGGGGAAAGCCATCATGGATGAGCATCCCTAGTACTGTAGAAATCAAGAACATG ATTTCATTGGTGGATGTAAGTGATGGGATTGGCATAGAAGTGCGCTTGACTTTGAAGGAC GAAGATATGGCCATAATCGAAAGCAACCAGGAGATGCTTGCATATGCTTCTCTGAATCCA AGTGTCGTGTAA
PEP MTSEIKVEVIREETVRPFSPTPHHLRSSNLSVFDQLTPQVYVPLLLFYPSNNSNHHSAAS ASERSKLLKRTLSETLSHFYPFAGTIQSNDVSICCNDHGATFVEARVNCPMSKISEKPDL GIQKQLHPNELEFMAQSGTGHLLLVQANFFECGGVAIGLNISHKIIDAYTLCKFINSWAA ISLGSANTDHVVPPVEFGAAASLFPPLDFLNSPQPSIDFVKENCITRRYVFDASKIAALK SKAASAAVPNPTRVEVVSALIWKCVMEASRSNSNFARPSVWCQFVNMRKMLPQAPGENLL GNLVGYSVAKTEEREVEHDVKSLVSKLRKGLEEFKEKYGNGISREDVFQQCIELSKLVGK VDIDTYCSTSWCRFPFYEADFGWGKPSWMSIPSTVEIKNMISLVDVSDGIGIEVRLTLKD EDMAIIESNQEMLAYASLNPSVV


| Top |