Cherry SNP DataBase

Gene information

Gene Pav_sc0000095.1_g1560.1.mk
Chromosome name PAV_r1.0chr4
start 11266436
end 11269547
PAV_r1.0 name Pav_sc0000095.1
start 811246
end 814357
direction +
Annotation NR PREDICTED: fatty-acid-binding protein 3
Sequence CDS ATGTTTGAAGCTCAAGCAATTTGCACTCCAACAAGGCTCCAATTACCCAAATTTACCAGA AACTGCATTTCCAGACCCAGAATTGGCTTTGTGGCTAGAATTTCAAATCCAAATGAACTG TTGTGCCAAACCCACTCTTGCTCTTTCTTGTCTCCTCCAGAGGACATTAGAACTCAGACC CGTTTCACATTCAATGCTTCCTCATCTTCAGTTGGAAGTGCAGAATACATAGAGGAACCT GCTACCAAAGTGAGATTTCAGACATCTTTGAGCTTGCCAGGTTGCTCGAGTTCATTGTCG TTGCTTGGAACTGGATACAGGGAAAAAGTCTTTGCAATTATTGGCGTTAAAGTCTATGCT GCAGGGCTATATGTGAACCAGTCCATCTTAAATAGTTTGAATGCTTGGAAAGGAAGATCA GCTGCTGAGATTCAAGAGAATTCGTCATTGTTCAGCACCATTTTTCAATCTCCTCTGGAG AAATCATTACAGATTGTTCTGGTTAGAGATGTTGATGGTAAAACTTTTTGGGATGCCTTG AATGATGCTATCTCCCCAAGAATCAAATCACCCACTCCTGTTGATGAATCAGCACTGTCC ACATTCCGTAGTATCTTCCAAGGGCAACCCCTTAAAAAGGGAACTTTCATATTTTTGACT TGGCCAGACCCTTCGAAAATGCTTGTTTGCATCTCCGCGGATGGGCTTCCTTCTAGTGTG GATGCTGCAATAGAATCAGAAAATGTGGCTTCTGCTCTTTTCGATGTATTCTTTGGAGAA ACTCCAGTTTCTCCCTCCTTAAAATCATCCGTTGTGAATGGACTGGAATCAGTCCTCAAG TAG
PEP MFEAQAICTPTRLQLPKFTRNCISRPRIGFVARISNPNELLCQTHSCSFLSPPEDIRTQT RFTFNASSSSVGSAEYIEEPATKVRFQTSLSLPGCSSSLSLLGTGYREKVFAIIGVKVYA AGLYVNQSILNSLNAWKGRSAAEIQENSSLFSTIFQSPLEKSLQIVLVRDVDGKTFWDAL NDAISPRIKSPTPVDESALSTFRSIFQGQPLKKGTFIFLTWPDPSKMLVCISADGLPSSV DAAIESENVASALFDVFFGETPVSPSLKSSVVNGLESVLK


| Top |