Cherry SNP DataBase

Gene information

Gene Pav_sc0000095.1_g550.1.mk
Chromosome name PAV_r1.0chr4
start 10717990
end 10731846
PAV_r1.0 name Pav_sc0000095.1
start 262800
end 276656
direction +
Annotation NR PREDICTED: ankyrin repeat-containing protein At5g02620-like
Sequence CDS ATGAAAGCTGATCCTCGATTGTGTCGTATTACAAATAAAGCAGAGGAGTCACCCTTGTTC CTTGCTGTTAGAAAAAGATCTCCAAACATTGCTCATTGTATTTTACAGGCTTACGAGTCC GACATTTCTCCTTCTTTCCGAGGGACTAACGGACTGACAGCTTTGCATGTGGCAGTGACT CAAGAAAAACTCATAGACAAAGTAATGTTTATACATGAAACATGGTACGTAGGCGTTGTC AAGATGATGATGTCCAAAAATCAAGACATAATCAGAGAAGTTGATGCTATTGGATGGACC CCCTTGCACTACGCAGCATTCACAGGGCACGTTGAAGCGACTCGACTACTGGTGAAATGT GATAGCTCAACTTGTTACATGCTGGACAACTCTAAAATGTCAGCTCTCCATGAATTTATC AACATATGTCCAGTGTTGCAACAGTTGGGGCCCTCCGTGGGTGCATTTGCTCTCATCCCC GTTGTTACGTTTGTATATCAAAAGCTCAGGGAGAGACAAGTCAGCAACCGCGATGCCTTC AATAGTCCGCTTTTGTTCAACCTGGGACGCTCTAGTGGTGTCCCATTTTTCCAGCAACAA ATCCGCAGTGATGTCATGAAATTGGAATCTCTAGGTACTATACGCACACCAAACATTGCA AACAAGAGAGAAGAGCTGCAAGATTATTCACCAGCAGACAAGAAAGGATGTGATACTGAT CTTCTGATTGCTATGCTTATCGCTACAGTTACATTTGCTGCTGCTTTCACCTTGCCCGGA GGATTTCAGAGCGACGGATTGGCGGTTTTACACGCAAAGCCGTCTTTCCAAGTGTTTGTG TTATTTGACACCTTCTCCTTTTTTCTGGCTGTTCTTGTGTTGTGTCATTATTTTATGGCG GGAACCGACTCGCGAGTCATTCTCGCCAGACCTGCAACTCTCATTAAGTGTTCCTTTGGA GCAATGGTGGTTGCATTTGCTTCCGGATTATTTGTAGTGCTACCCATGCAAAGTCCGGTT GGTACTGTGGTCCTTTACATATGTGGCATTTTATGCTTACTTGTCCTTTTTAGTTTTAGG GTTGTCAACCAACAAAGTAGTCGCGAAAGGAAGATGCGCAGATGGCTCCGCTCCCGCATA ATATAA
PEP MKADPRLCRITNKAEESPLFLAVRKRSPNIAHCILQAYESDISPSFRGTNGLTALHVAVT QEKLIDKVMFIHETWYVGVVKMMMSKNQDIIREVDAIGWTPLHYAAFTGHVEATRLLVKC DSSTCYMLDNSKMSALHEFINICPVLQQLGPSVGAFALIPVVTFVYQKLRERQVSNRDAF NSPLLFNLGRSSGVPFFQQQIRSDVMKLESLGTIRTPNIANKREELQDYSPADKKGCDTD LLIAMLIATVTFAAAFTLPGGFQSDGLAVLHAKPSFQVFVLFDTFSFFLAVLVLCHYFMA GTDSRVILARPATLIKCSFGAMVVAFASGLFVVLPMQSPVGTVVLYICGILCLLVLFSFR VVNQQSSRERKMRRWLRSRII


| Top |