Cherry SNP DataBase

Gene information

Gene Pav_sc0000095.1_g610.1.mk
Chromosome name PAV_r1.0chr4
start 10758268
end 10762531
PAV_r1.0 name Pav_sc0000095.1
start 303078
end 307341
direction -
Annotation NR PREDICTED: LOW QUALITY PROTEIN: endoplasmic reticulum oxidoreductin-1-like
Sequence CDS ATGGAAGTGGCATTGGAGAAGAATGAGAAAAAAAGCAAGAGATGGGCAGCTTCTCTTGCT TTTTTGGGTGCTGTGGTGGTGGATTCAAAAGGGTACACAGGCATTGTGGAGGATTGCTGT TGTGATTATGAAACAGTGGACAGTGTTAATGCAGAAGTGTTGCACCCACTGCTACAAGAG ATTGTTAAAACTCCATTTTTCAGATATTTCAAGGCCAAGCTCTGGTGTGACTGTCCCTTT TGGACTGAAGACGGTATGTGCCTCTTGCGTGACTGCAGCATCTGTGAGTGCCCAGAAAAT GAATTTCCAGAACCTTTTAAGAGGCCCTTTCTCCAGGGCCTTGCACCTGACAGTTTTGTG TGTCAAGAGGGAAAGCAGCAGGGGACTGTTGACCGGACGCTAGACAGTAGAGCTTTCAGA GGCTGGGTTGAGACAGATAATCCTTGGACAAATGATGATGAGACGGATAATGGTGAGATG ACATATGTGAACCTTCTATTGAACCCTGAACGTTACACTGGCTATGCTGGTCCATCACCG AGAAGGATATGGGATGCTGTGTATTCTGAAAATTGCCCGAAATATTCATCTCAGGACATT TTCCAGGAGAAAAAAGTATTATACAAATTAATATCTGGTCTTCACTCCTTAATTTCAATC AACAAAGCTGCTGATTATCTTCTTGATAAGACTACTAATCTGTGGGGTCAAAATCTGGAG CTGATGCATGATCGCGTTTGGAAATATCCTGATCGTGTCCAAAATTTGTACTTCACATTC CTCTTTGTTCTCCGTGCAGTGACTAAAGCAGCAGATTACTTGGAGCAGGCTGAGTATGAC ACTGGTAATCATGAGGAAGACCTGAAAACTTGGTCTTTGATGAGGCAGCTACTCTACAAT CCTAAACTCCAAGCTGCATGTCCTCTACCATTTGATGAAGCAAAGCTCTGGAAAGGTCAA AGCAGAGCCCAACTAAAGCAACAGATTCAAAACCAATTCAGAAACATTAGTACTTATTTC ATCCTCAAATTGCAGTGCATTAATGGATTGTGTGGGCTGCGAGAAGTGAAGGCTTTGGGG AAAGCTTCAGGCAATCGGCATATGACAAAGAGCATGGGGGTTGCTGACGACCGGGCTGAG GTTTGGGAAGCTTATAATTACAAATGTAAGTTGATCCCCCAATCTTCAAATACCAATTTT GGAAGCAGTGCAAAGCATATATCACACACTGATTCGTTGACCATATACTTTTCGTAG
PEP MEVALEKNEKKSKRWAASLAFLGAVVVDSKGYTGIVEDCCCDYETVDSVNAEVLHPLLQE IVKTPFFRYFKAKLWCDCPFWTEDGMCLLRDCSICECPENEFPEPFKRPFLQGLAPDSFV CQEGKQQGTVDRTLDSRAFRGWVETDNPWTNDDETDNGEMTYVNLLLNPERYTGYAGPSP RRIWDAVYSENCPKYSSQDIFQEKKVLYKLISGLHSLISINKAADYLLDKTTNLWGQNLE LMHDRVWKYPDRVQNLYFTFLFVLRAVTKAADYLEQAEYDTGNHEEDLKTWSLMRQLLYN PKLQAACPLPFDEAKLWKGQSRAQLKQQIQNQFRNISTYFILKLQCINGLCGLREVKALG KASGNRHMTKSMGVADDRAEVWEAYNYKCKLIPQSSNTNFGSSAKHISHTDSLTIYFS


| Top |