Cherry SNP DataBase

Gene information

Gene Pav_sc0000095.1_g890.1.mk
Chromosome name PAV_r1.0chr4
start 10905013
end 10919189
PAV_r1.0 name Pav_sc0000095.1
start 449823
end 463999
direction -
Annotation NR PREDICTED: ubiquitin carboxyl-terminal hydrolase 25
Sequence CDS ATGGGCCTGCAATTTCAATTGCAGATGAGTTGGCAGCCGAGTCTACTGAGTCACAAGCGC AAGACGGGCCCACCTCTAGGGTTAACGAACCTCGGCAACTCTTGCTACCTCAACAGCGTC CTTCAGTGCCTCACCTACACCCCTCCTCTCGCCAATTTCTGCCTCCGCAACCAACACACC TCTCTCTGTGACTCTTCGCATGCGGAGCGGAAGCGCGACTGTCCATTTTGCATTTTGGAG AAGCGAATAGTGCGCTCGCTCAGTCTGGATCTCAGTCTAGATGCGCCGCGGAAGATACAG AGCTGTCTCAGGATTTTCTCCGAACACTTTCGGTGCGGTCGCCAGGAAGACGCACACGAA TTTCTCCGCTACGTGATCGATGCTTGCCACAACACCTGCCTTCGCCTCAAGAAGCTGCGG CGCACTGCCAGCTCTAATGGCAACGGCAACGTGGCCAATGGCATAGGTAATGGGACGACG ACGACGACGTCGACTGTGGTGAAGGAGATATTCGGGGGAGCTTTGCAGAGCCAGGTGAAG TGTCTATCCTGTGGCACAGAATCCAATAAGGTTGATGAGATAATGGATATTAGTCTTGAT GTTTTTCATAGTAATTCGGTTAAAGACGCCCTGCAAAGGTTCTTTCAGCCTGAGCTTTTG GATGGCCAGAACAAGTACAAATGCGAAAGGTATTTATGCTTTCTTAGTTGTAACAAATTG GTGGCAGCAAGGAAGCAAATGTCTATTCTTCAAGCACCCAATGTTCTTGTTATCCAACTT AAGAGATTTGAGGGTATATTTGGCGGGAAGATTGATAAATCTATTTCATTTGAGGATGTT TTGGTGCTCTCAAGCTTCATGTGCAAAGCAAGCCAGATGCATCATGATCTTTGTATTTTT TCTTGCATATCAAATGCACACAATTTCTTTCCTACTAGTAATGCTGTTGAATTTTTAACT GCAATGCAGGATCTGCGGCCTGATTATAAGCTTTTTGGTACTATTGTGCATTCAGGCTTC TCACCAGAGTCTGGTCACTATTATGCATATATTAAGGATGCCATGGGTCGGTGGTATCGC TGCAATGATTCATTTGTCTCGCTTTCCACCTTGCAAGAGGTATTATCTGAAAAGGTTTAC ATCCTTTTCTTCTCTCGTACCAACCAAAGGCCAGCAGCTAGCACTGCTTCCAATGGGGTG AGTTCTCGTGATTGTAATGGCCATGAAACATCTAAAAGCCCAAAGCCTGCTCTTCCACCG AAAGGAGCACAAACAAAACCTTATGAACAGTCTTCTTGGAAGGATATCTCAGCCATATCT AAGGTTGATAAAGCGCCTTCTAGCCCACGGATGAAGTTTAATATCAGTGGAAATTCTAGC ACCAAAAGAGCTCCTGCAACTAATAATGGAAAATTTGCTTGCAAGAATCAATCCTTAGGA TCAAACGGGGAAAGAGCTCCTGGAACTGATAATGGAAAAGTTGCTCACAAAAATCAATCC TTAGGATCAAATGGGGAAAGACCTCGTGCAACTGATAATGGAAAAATTGCTTATAAGGAT GAATCATTTCGATCAGATGGGGAAAGAACTCCTCCTACTGATAATGGAAAAATTGCTCAC AAGAATCTATCTTTAGAATCAAATGGTGAAAGAGCACCTGCAACTGATAATGGAAAAATT GCTTACGAGAATCAGTCCATAGGATTGAATGGAGAGGTGAAGGACCCAGTTAGTTTGGAG AAACGTGAGAAAGCTAAGACATCTTTGATAAACAAGGATGGTTTACACAGAGATAAAAAG TCTGATATTATTGGTGGTAACAGTAGCAAAGCTTCTTTGTTATCACGAGAAAATGGTGGT ACTGGTTCAGTAAAAACTGAACTCTGTGAAGGTATTGGTACACGAGACAGGTTGACAGCA GGGGAAGTGCCTGATCACAGTGAATTGGATAATAGTGATCTCCATGGCCACTCTGGGGTC TCTGGGCCCAAAAGAAAATCTCAGGATTCATGCATTTTGTTTGCACGTGATGATCAATCC CGGGCAGAAGTTGAAGGACTGAAGGAAATTCTCAAGAAAGAAGCTTCTTCAGTTTTGCGA TCATGTGGCTGGTCAGATAAAGTGCACAGTTTTATGCGTTCAAAGAAAAGGTTATGTGCA CAGCAAGTTGGAACCGATCCGAACAGTGATGAAGTGAAGGAAGTTGTTGATCGTGGATTC CAAATCAGCTTTTCTTTCACAAATACCCGAGTCCTTGAGAGCGGACTTGGTCAACCGTAT TCGATCATTTAG
PEP MGLQFQLQMSWQPSLLSHKRKTGPPLGLTNLGNSCYLNSVLQCLTYTPPLANFCLRNQHT SLCDSSHAERKRDCPFCILEKRIVRSLSLDLSLDAPRKIQSCLRIFSEHFRCGRQEDAHE FLRYVIDACHNTCLRLKKLRRTASSNGNGNVANGIGNGTTTTTSTVVKEIFGGALQSQVK CLSCGTESNKVDEIMDISLDVFHSNSVKDALQRFFQPELLDGQNKYKCERYLCFLSCNKL VAARKQMSILQAPNVLVIQLKRFEGIFGGKIDKSISFEDVLVLSSFMCKASQMHHDLCIF SCISNAHNFFPTSNAVEFLTAMQDLRPDYKLFGTIVHSGFSPESGHYYAYIKDAMGRWYR CNDSFVSLSTLQEVLSEKVYILFFSRTNQRPAASTASNGVSSRDCNGHETSKSPKPALPP KGAQTKPYEQSSWKDISAISKVDKAPSSPRMKFNISGNSSTKRAPATNNGKFACKNQSLG SNGERAPGTDNGKVAHKNQSLGSNGERPRATDNGKIAYKDESFRSDGERTPPTDNGKIAH KNLSLESNGERAPATDNGKIAYENQSIGLNGEVKDPVSLEKREKAKTSLINKDGLHRDKK SDIIGGNSSKASLLSRENGGTGSVKTELCEGIGTRDRLTAGEVPDHSELDNSDLHGHSGV SGPKRKSQDSCILFARDDQSRAEVEGLKEILKKEASSVLRSCGWSDKVHSFMRSKKRLCA QQVGTDPNSDEVKEVVDRGFQISFSFTNTRVLESGLGQPYSII


| Top |