Cherry SNP DataBase

Gene information

Gene Pav_sc0000096.1_g170.1.mk
Chromosome name PAV_r1.0chr7
start 3585419
end 3595229
PAV_r1.0 name Pav_sc0000096.1
start 90859
end 100669
direction +
Annotation NR Heat shock protein DnaJ with tetratricopeptide repeat, putative isoform 1
Sequence CDS ATGACGCCGGCGGCAGTGGATTTTCGGTCTCCGATCACCTCTATACCGACCAAACCCTCC TCTACTCCTGAAAACCCTAACCCTGTACCCGATGTGGCGTCCTCTCCCACCTTTAACCTC GGTGCTTCAAACGACAATGGAAGTCAGTGTCAGTTCGGTCCGAGTGTGCCGTCGCGATTG GGTCGGTCGCGGCCGAGGTTTGTGAAGATGAGGAAGCAGCATTCGAGGTCAAGAACTGGG TCGGGTGAGAGTGGGCCGGGGGTCAACCCGTTTTGCTCGGTAAGTGATGGTACTAGTTCT TCCAATGGGTTTAATTTTTCTAATGGTGATTGTGGGGGTGTGGATTTTGTGTTTGGTGCT AGAAAGATTGGTGGTGATGAGAATTTAGATAATGGGGAGGGAGAAAGTGGTGGAATAGTG AGAAATTTGGATAATGGGGAGGGAGGGAGTAGTGAAATAATGAGAAATTCGAGTTGTGAT GATAATTTGGATAATGGGGAGGGAGAGTGTTGTGAGAAGGGGAAAATTTTGAGTTGTGAT GAGACGGGGCAGGTGAATACTGGGAATGGAAGAGGGTCTGATAAGCTGGAGAGTGTTTGT TATGAGTGTAGTGCAAAGCAGGATGGTCTGGGATCTAGTTTGTGTCGGGAAAAGAGAGAA TTTTGTGAAAATGTGAAAGCAATCGTTTCTGAAGATAAGTGGAATGAAAAAACAGAGACT GAAACAGAATGTCAGAAGGGTGATAACCGGGGTTTTGTGTTTAGTGCTAACAGCCGTGGT TTGAGTTCGGATTTGCAGTTGGATTCAAATCATGAAATGAGAGAATGTGGTGGATATGTG GAGAAACCGAGCACAGATAATAGTGGAAAAATGAAAATAGAGAGTGAAGTAGGGTATAAT GTGGGTTCTGGGCTTGGAGCTAGTCAAAGAGATTCAGCTCCGAAGTTGAATGCCGAAAAT GGGGAGTCTGCAAGTTTTGTGTTTGTTACTGGCTTGGATGATTTTGGGTCTACTTCAAAT ACAGGAAACAGAAAACACAGTGAAAATGAGGGGACGCCAGGTTGTGATGGTATTGGCAGT ACAGAAATTGATAATGAAGCTGAGGAAAAGAAGTACAATGATATGGGTTTTGTGTTTGGT TCTAGTTGGAATTCCTTGAATTCAGGAAATAAAAGCTCTAGTGGAAAACTGGAAAAGTTG GCTCCTGATGTTGGTGGGAAGATGAAAGTTGAGAGTGAAACAGAGTTTGAGAAAATGGAA GCTGATCCTTTTAAATTTCATGCTGAGGAGCGTTGCATCTCAAATAAAGATCATGATAAG GGCTTTTTTGTATTTGGAAGCAGCACTAAGAAAGGTTCCAGTTTGACTGAATGCAAGGTC ACGAAGTGTCAAGATGAAATGAAACTGAGTAGTGAAAATTTAGGAGATTGCAAGACCAAT TCAGAAAGTAATTCTTGTGGTCAGTGTTCAGGAGGTCCTTATGTTGCCTCAGAGAAAAAT AATGGAGATAATGATGAAAGTAGTGACCAGAACCATATCTTCTTTGAAAGTGATAGAAAC ACGAAGGGTGCCACTATAGGAATTTCTGGTTCCAAAAAATTTACATCTCAGGCAGGAAGT GATGAGAGTGTTGAGCCAGGACAGTTTTCTCATTATCAAATTAAGAATGATACACACCCA AATGTAGCTGCTGCACCATGTTCATCCTCATCAATTGGTCCTGGCATCAAAACCAATGGT TGTGTTTCTGAAGCAGCTTCTGTGGGTGGAGTAAGAAAGAAAGATGAAAATAGTTCTACT GGCTTTCCAGATGGTTTTGGAGTGTGCTTTGAGGACTTGAAAACGTCATTTTTGGATCCT TCCTGTCTTAGAACAAATCTATTTCCTGAATTAAATAAAACTTTGGAGTTCAGTGTGAAG GGTAGGTCATTTAGGGACAAAAGATCAAGGAAACAAAGGGGAAAGTCGAAGCTGAGTAAG CAATGGCCAGTTCAAGATCATGTGCCCAAGGAAAGTAGTTCCCAAGGAAACCCAGACGCT TCTGGATGTTACTCACCCATGGATTTCTCTCCCTATGAGGAAACAAGAGTTGCTGATCCA CATTCAAGGGAAACTTCTGTGGCATCTACTGACTCCTTCCACCTAGTCAACGATAGTGCA CCCTGTGCCTCCAATGCAGCAGTTCCTGCTGATCCTAAAGGTGAAGATTTGGTTGCTGCA GGAAGTGGGTTGGATGACAGAGGTGATCGGATATGTAAAGAGCCCATTGAGGAGAATTCG AGGTCTCATGGTGAGAAAATCTTTTTCCATGATTTTTTGTGGAAAGGGTCTGGTTCTGGA GCTGAACCTGAAACTCCCTGCTTTAGTTCCAAAAGTGAGCATGTGAGTAGTATCAGTGGT GCTGGTTTGGATTCAGAAGAAGCTAGAGTTGGCATTGGCTTAAATATAGAGAGTCAAGAA AGTGATTGTAAAACACCACTTTTTGCTTCAGGTTTTGAAAATATGAAAGATAAATACTTC ACATTTTTGGCATCGTCTTCTACTCAAGGTAGCTCAATGATGACAAAGCGCCAACAGCGT AGAAAGAAAAATAGGATGAAAGTTGGTCATGAGACGTTTGTTATAACTCCAAGTCCGAAT GTTGAGTTTGGATCTTCTGACCTATTTACCCTCCACTCTAAGGAACCTTTATCTGCAGAT GTAGTTGGTAAATCTGAAGCAAATGAACAATTTAAGCAAGTGAATATCTCTTCTAGTGCT GCTACTCATGAAACCTGTGAGAAATGGCGGCTCAGGGGAAACGAAGCTTATAAAAATGAA GATCTTTCAAAAGCTGAAGATTTTTACACACAGGGAATAATTTCTATACCTTCTAATGAA CGTTCAGGATGCTGCCTTAAGCCTCTTTTGCTATGCTATAGCAACCGTGCTGCAGCAAGA ATGGTTCTTGGAAGGATAAGGGAAGCTTTAGGGGATTGTGTGATGGCTACTGCATTAGAT CCCAACTTTCTCAAAGTTCAAATGAGGGCTGCTAATTGCCATCTTCTGCTCGGTGAAGTT GAAATTGCACAGCAGTACTTCAATAAGTGCTCAGAATCAGGAAGTGGTGTGTGTTTGGAT CGAAGAGTTGTAATAGATTCTGCAGATGGCCTACAAAAAGTTCAGAAAGTGGTCGAGTAT ACAAATCGTTCTGCCAAGCTGCTGGACCAGAGAACTACTGATGCGGCTCTCACTGCTTTA GAAATAATTTCTGAGGCCTTGTCAGTTAGTTTGTACTCGGAAACATTGCTCGAAATGAAA GCAGAGGCTCTGTGTTTGTTAAGGAGGTATGAAGAGGCGGTTCAGTTGTGTGAGCAGAGT TTGTTTTTTGCTGAAAGGAATTTCGCTCCACTGAACAATGTTAGGTTGTGGAGGTGGTTC TTCATATCCAAGTCTTACTTTCATTTGGGTAGGCTTGAGGCAGCTCTTGATTTACTCGAG AAGCTAGAGGAAGTGGAATCTACTAAAGTCATGTATGCAAGTAAGAAATTGGAATTAGCG GTTTCGTTAGCTGTCACCATACGCGAACTATTAAGCCACAAGAATGCAGGCAATGAAGCA TTTAGATCAGGAAGATATGCAGAAGCATTGGAACATTATACTGTTGCTTTATCTAGCAAT TTCGGATCTCGTCCATTTTCAGCCATCTGTTTGTGCAACCGTGGTGCAGCACACCAAGCT TTGGGTCAAATTACTGATGCCATTGCAGACTGCAGTCTTGCCATTGCTCTTGATGGAAAT TATGTAAAGGCAGTTTCTAGAAGAGCCACCTTGCATGAGATGATACGAGACTATGGACAG GCAGCTAGTGATCTCCAAAGACTTATATCCATTCTGGAAAACCAATCTAATGACAAAGCC AAAGAGTGTAGCTCAAAAGGTAGATCCAATGGCAGTGTAAAAGAATTACGGCATGCTCAT CGACGAATGCCTTCGATAGAAGAAGAAGCTAAGAAAGGAATCTCGTTGGATTTTTATCTC ATTTTGGGAATTAAACCATCTGATGCAAGTCCTGATATTAAGAAGGCTTACCGGAAGGCA GCTCTCAAGCATCATCCAGACAAGGCTGGCCAATTCTTGGCAAGGAGTGAGAGTGGAGAT GAAGGGCAACTCTGGAAAGAAATCTCCCAGGAGGTTCACAAGGATGCTGACAGGCTCTTT AAAATGATTGGAGAGGCATATGCAGTACTTTCAGACCCAGCTAAGCGCTCACAATATGAT CTTGAGGAGGAGATGAGAAAAGTAGAAATTGAAAGCAAGGAAAGCGGCATTTATAGAAAA TCTTCAGATTTTCAGAGTCCTGGACGCAACAGTTATAGAAGACCTGATTTCCATAGCTCT CCATTTGAGAGAAGTTCTAATAGTCGGACCTACGGCAGGGAGAATTGGAGAACATATGGA AATTCGTATTCTCGATGGTAA
PEP MTPAAVDFRSPITSIPTKPSSTPENPNPVPDVASSPTFNLGASNDNGSQCQFGPSVPSRL GRSRPRFVKMRKQHSRSRTGSGESGPGVNPFCSVSDGTSSSNGFNFSNGDCGGVDFVFGA RKIGGDENLDNGEGESGGIVRNLDNGEGGSSEIMRNSSCDDNLDNGEGECCEKGKILSCD ETGQVNTGNGRGSDKLESVCYECSAKQDGLGSSLCREKREFCENVKAIVSEDKWNEKTET ETECQKGDNRGFVFSANSRGLSSDLQLDSNHEMRECGGYVEKPSTDNSGKMKIESEVGYN VGSGLGASQRDSAPKLNAENGESASFVFVTGLDDFGSTSNTGNRKHSENEGTPGCDGIGS TEIDNEAEEKKYNDMGFVFGSSWNSLNSGNKSSSGKLEKLAPDVGGKMKVESETEFEKME ADPFKFHAEERCISNKDHDKGFFVFGSSTKKGSSLTECKVTKCQDEMKLSSENLGDCKTN SESNSCGQCSGGPYVASEKNNGDNDESSDQNHIFFESDRNTKGATIGISGSKKFTSQAGS DESVEPGQFSHYQIKNDTHPNVAAAPCSSSSIGPGIKTNGCVSEAASVGGVRKKDENSST GFPDGFGVCFEDLKTSFLDPSCLRTNLFPELNKTLEFSVKGRSFRDKRSRKQRGKSKLSK QWPVQDHVPKESSSQGNPDASGCYSPMDFSPYEETRVADPHSRETSVASTDSFHLVNDSA PCASNAAVPADPKGEDLVAAGSGLDDRGDRICKEPIEENSRSHGEKIFFHDFLWKGSGSG AEPETPCFSSKSEHVSSISGAGLDSEEARVGIGLNIESQESDCKTPLFASGFENMKDKYF TFLASSSTQGSSMMTKRQQRRKKNRMKVGHETFVITPSPNVEFGSSDLFTLHSKEPLSAD VVGKSEANEQFKQVNISSSAATHETCEKWRLRGNEAYKNEDLSKAEDFYTQGIISIPSNE RSGCCLKPLLLCYSNRAAARMVLGRIREALGDCVMATALDPNFLKVQMRAANCHLLLGEV EIAQQYFNKCSESGSGVCLDRRVVIDSADGLQKVQKVVEYTNRSAKLLDQRTTDAALTAL EIISEALSVSLYSETLLEMKAEALCLLRRYEEAVQLCEQSLFFAERNFAPLNNVRLWRWF FISKSYFHLGRLEAALDLLEKLEEVESTKVMYASKKLELAVSLAVTIRELLSHKNAGNEA FRSGRYAEALEHYTVALSSNFGSRPFSAICLCNRGAAHQALGQITDAIADCSLAIALDGN YVKAVSRRATLHEMIRDYGQAASDLQRLISILENQSNDKAKECSSKGRSNGSVKELRHAH RRMPSIEEEAKKGISLDFYLILGIKPSDASPDIKKAYRKAALKHHPDKAGQFLARSESGD EGQLWKEISQEVHKDADRLFKMIGEAYAVLSDPAKRSQYDLEEEMRKVEIESKESGIYRK SSDFQSPGRNSYRRPDFHSSPFERSSNSRTYGRENWRTYGNSYSRW


| Top |