Cherry SNP DataBase

Gene information

Gene Pav_sc0000096.1_g580.1.mk
Chromosome name PAV_r1.0chr7
start 3846248
end 3861694
PAV_r1.0 name Pav_sc0000096.1
start 351688
end 367134
direction +
Annotation NR PREDICTED: uncharacterized protein At2g41620-like
Sequence CDS ATGGCCACCGACCAAAACATGAGCAGCTGGACCGATCTGCTCCACTCCTCCACCAAGCTT CTCGAACAAGCCGCTCCTTCCGCGCAGTTCCCTCCTCTACAGAGAAATTTGGATCAGTTA GAAACATTATCGAAGAAACTCAAGGCGAAAACTCTACGAACTGAGACTCCTCAACAATCC ATTGCTGCCACGAGGCTTCTTGCACGTGAGGGACTAAATGCGGAGCAGCTTGCACTTTTG GAGGAGGATTGGCAGAAAGAAAAACGTGATTTCCTTCAAAGTCTAAGTCAGATTTCAACA TTACCCAGGACTAACATGACTTATACTAGCAGCGCTGGTAGTCGTTCTGGTCAAATAGCG TCCATAACTTCTAGCCCTCAAGTTTCATCTACTCCATCTAGTATGGAGCTTGTACCTTTA GCTAGCAAGCCCATCCTTGAGAAGAAAACATCTGTCTATGCAGAAGTTGTTAAAAATCTG AATAATGCAAGGCAGCGTGGATTACCGTTTAAAACATTAATGGGCGAAGATATAACCATA CAACGGGGTGCTTCGAAACGGATGTCATTAGTTATTGGGGCAAGGCGCCACCTGGAATGG GGGCATGAAAAGTACATCATGGATACAATCCAAAGTCATCCTGCACAGGCAGCCCTTGGA GGAGTTGTTGGAAATTTACAAAGAATTCGTGCCTTTCTTCGGATTCGTTTAAGAGATTAT GGAGTTCTAGATTTTGATGCAGGCGATGCTCGTAGGCAGCCTCCTGTTGATACCACTTGG CAGCAGATCTACTTTTGCTTGAGAACTGGGTATTATGATGAAGCAAGAGCTGTTGCTTTG TCATCTCGCGTGTCAAACCAGTTTGCTCCTCTGCTTACTGAGTGGATTAATACTGGAGGT ATGGTGCCTGCGGAGATTGCAGCTGCTGCATCAGAAGAATGTGAAAAAATGTTAAGAACA GGTGATCGTGTGGGCCGAGCTGCATATGACAAGAAAAAGTTGTTACTATATGCTCTCATA TCTGGTTCTCGTAGGCAAATCGACCGCCTACTAAGAGATCTACCTACTCTTTTTAACACC ATAGAGGATTTCTTGTGGTTCAAATTGTCAGCTGTAAGAGACTGCCCTGGTGGAGCTGCA CCCATTGTCATGAATGAGAGCTTGGTACCATACACATTGGATGATTTGCAGATTTACTTG AATAAATTTGACCCCTCATACTATACAAAAAATGGAAAGGACCCTCTGGTGTACCCATAT GTTTTGCTTTTAAGCATCCAGTTGATACCAGGTGTGGTATACTTGTCCAAGGAAACTGGA GATGAAGGATATAACATTGACGCTGCCCACATATCAATTGTGCTAGCAGACCATGGGGTC CTTTCTGAAGGAGCTGGGGCTGGACAGAAAATGGGCGTGATGGATGCTTACGCAGAGGCA TCTAGTATAATCAGGCAGTATGGGTCTGTGTATTTACGTCTTGGTAATCTTCAGGTGGCA TTAGAATATTATGCACAAGCTGCTGCTGCAGTTGGTGGTGGGCAGTTGTCATGGTCTGGA AGAGGTAATGTGGATCAGCAAAGGCAGAGAAATTTGATGCTGAAGCAGCTCCTTACAGAA CTGTTGTTACGGGATGGGGGCATCTATCTTTTACTTGGTTCAAGAGGTGCCGGAGAAGAA GGTGAATTGGGGCGATTTTTGACTGATGCAAAAGAAAGACAACAATTTCTGCTTGAAGCT GCTCACCAATGTCAGGAAGCTGGATTGTATGAAAAGTCTATAGAAATTCAGAAACGAATA GGGGCATTCTCGATGGCATTGGATACGATTAACAAGTGCCTTTCTGAAGCTATTTGTGCC CTCTCACGTGGTAGATTGGATGGTGAGAGTCGAACTGCTGGTCTCATTCACTCTGGAAAT GAGATCTTGGAGATGCACAAATATTATCCTGAAATCAGTCCTCAAGAGAGGGAAAGTGTT TCAGAGCAGCATATTGTGTTAAGACAACTTGAGGCCGTACTGTCAATCCATAAATTGGCA AGAGGAGGCCATTATGCTGATGCTTTGAGGGAGGTTGCCAGACTTCCATTTCTTCCATTA GATCCCCGGACACCAGATGCTACCACTGATGTGTTCCAGAATTTATCTCCTCATGTCCAA GCCTGTGTTCCGGACCTCCTGAAGGTTGCACTCACTTGTCTGGACAACATGGTGGATTCT GATGGATCGCTTCGCGCCTTGAGGGCTAAGATTGCTAGCTTCATTGCAAATAATTCCAGT AGGAATTGGCCTCGCGATTTGCAAGCTGAAGTGAGTTGTGGTCGGATTTCTCCGGCGACA TATGAGCATCAAAATCACGCGCATTACATATTTACCGCAATACCAGTGACCGCTACTGTG TGTCACCGTCACCCCTTGCACGCCGGTAGGCGTCGAAGAGTCACCGGCCGACGGAAGCAA GTCAGCAACACCAGTCGCTGCCAGGTCGTGGATTGGGGGAATTATTTAGGGGAGAGTGTT TCTGAGGCCCGTGCACAACATGCCAACAGCACTGATGAAGAAAATCACTATGCTTCTGGG TGTGCATCCAAGTTTCAGCCCAGGAAAATCACATCCAAGGCTCACTGGAAGGACCAGATG GGCATGGCTGAGGTGGTAGTTGAAAAGGGTAGATATCGGATATCCACGGGAATTGTGCGC CATAGCAAGCTCTATTACTCTATTGAGGAAGTTTTGTTTTTGGTTGAAATAGGCGACTTG CTTCTCTTGGATGATAGTGGTACACTTTCCTTGGAAGATATATATATGAAGATTTCAGAT AGAAGGAATGGGTGTTCTTGGGAGGAATTTCAAGCTTATAGGCAACTCAAGTCTCTTGGT TACATTGTTGGGCGGCATGGTATCCCCTGGTCTATGAAGAGTTTGAAGAGTAATTATGAA ACTGTTTGTTCTCAACGTTGTCCGGAAAGTGATGAGGTGGTGGAATTGGGATCAGAAGAG ACTAGGTCTGTCATTGGATTGTTCCATGGGATGCAAATAAATGAAGCAAGGCTGATTTTT GATGTTTATCTCCCAAATAGCAAGTTCAGGAAGTCTTCTCCTGGTGATCCAAGTTTTGTG CTCTGCTTTACTAGGGGTCCTCCACCATCCAAAGCAGACCTTGAAGCCCTCGAGAGACAA TGTGAGAACATTCCTTTGAAGGTTTGCCATGAAGAGCAAGGGTGGGTGAGTTTCTTTTCC TTTGACAAGGTGGAACTTCCTGTCCTACCTTGA
PEP MATDQNMSSWTDLLHSSTKLLEQAAPSAQFPPLQRNLDQLETLSKKLKAKTLRTETPQQS IAATRLLAREGLNAEQLALLEEDWQKEKRDFLQSLSQISTLPRTNMTYTSSAGSRSGQIA SITSSPQVSSTPSSMELVPLASKPILEKKTSVYAEVVKNLNNARQRGLPFKTLMGEDITI QRGASKRMSLVIGARRHLEWGHEKYIMDTIQSHPAQAALGGVVGNLQRIRAFLRIRLRDY GVLDFDAGDARRQPPVDTTWQQIYFCLRTGYYDEARAVALSSRVSNQFAPLLTEWINTGG MVPAEIAAAASEECEKMLRTGDRVGRAAYDKKKLLLYALISGSRRQIDRLLRDLPTLFNT IEDFLWFKLSAVRDCPGGAAPIVMNESLVPYTLDDLQIYLNKFDPSYYTKNGKDPLVYPY VLLLSIQLIPGVVYLSKETGDEGYNIDAAHISIVLADHGVLSEGAGAGQKMGVMDAYAEA SSIIRQYGSVYLRLGNLQVALEYYAQAAAAVGGGQLSWSGRGNVDQQRQRNLMLKQLLTE LLLRDGGIYLLLGSRGAGEEGELGRFLTDAKERQQFLLEAAHQCQEAGLYEKSIEIQKRI GAFSMALDTINKCLSEAICALSRGRLDGESRTAGLIHSGNEILEMHKYYPEISPQERESV SEQHIVLRQLEAVLSIHKLARGGHYADALREVARLPFLPLDPRTPDATTDVFQNLSPHVQ ACVPDLLKVALTCLDNMVDSDGSLRALRAKIASFIANNSSRNWPRDLQAEVSCGRISPAT YEHQNHAHYIFTAIPVTATVCHRHPLHAGRRRRVTGRRKQVSNTSRCQVVDWGNYLGESV SEARAQHANSTDEENHYASGCASKFQPRKITSKAHWKDQMGMAEVVVEKGRYRISTGIVR HSKLYYSIEEVLFLVEIGDLLLLDDSGTLSLEDIYMKISDRRNGCSWEEFQAYRQLKSLG YIVGRHGIPWSMKSLKSNYETVCSQRCPESDEVVELGSEETRSVIGLFHGMQINEARLIF DVYLPNSKFRKSSPGDPSFVLCFTRGPPPSKADLEALERQCENIPLKVCHEEQGWVSFFS FDKVELPVLP


| Top |