Cherry SNP DataBase

Gene information

Gene Pav_sc0000099.1_g300.1.br
Chromosome name PAV_r1.0chr7
start 13576577
end 13577811
PAV_r1.0 name Pav_sc0000099.1
start 119628
end 120862
direction +
Annotation NR PREDICTED: putative ribonuclease H protein At1g65750
Sequence CDS ATGCATCGAAACAATCCTTGTCTATGTGATCCTAGCCGCTGTATGGATTTCATTTCAGAA GGCAACGTGGTAATTCTGCTCACGATTACTTGTGAACGCCTAAAAGGGGGAGTTATACGT GATTCCTCTGGGGATTGGACTTGTGGGTTTGTTGCTAATTTGGGCAGAGGTCAGATCCTT GAGGCTGAAATGTGGGGCTTGTTTTTTGGGTTAAAGCTTACTAAGGACAGAGGTATCTGC AATCTGTTCGTGGATATGGATTCTGCAGTGGCTGTTAAGTTGGTGAAGAACTCTACTGCT CTTGGTTTACATCCTGTGGCGTCTCTGGCTTCATGTTGCTGGGAGCTTATGGGAAAGTTT GATTCTTGTGCTCTTCAACACATTTATAGAGAAAGAAATATGGTTGCTGACTGTGTTGCG CAATGGGGCTACAATATGGACTTAGGTGTTTGTCTTTTTGATATGGCCCAAAGTTGGATT GGCGCTAGCCTTGTTGATGATCTGCTTGGAGTCACTAGGACTCGGCTAGTCTGTAATGAG TAG
PEP MHRNNPCLCDPSRCMDFISEGNVVILLTITCERLKGGVIRDSSGDWTCGFVANLGRGQIL EAEMWGLFFGLKLTKDRGICNLFVDMDSAVAVKLVKNSTALGLHPVASLASCCWELMGKF DSCALQHIYRERNMVADCVAQWGYNMDLGVCLFDMAQSWIGASLVDDLLGVTRTRLVCNE


| Top |