Cherry SNP DataBase

Gene information

Gene Pav_sc0000099.1_g520.1.mk
Chromosome name PAV_r1.0chr7
start 13479488
end 13487531
PAV_r1.0 name Pav_sc0000099.1
start 209908
end 217951
direction -
Annotation NR PREDICTED: GTP-binding protein ERG
Sequence CDS ATGGAAGAAGGGCGAGCCATGCCGACTTTCACTGTCATAGCTTTAGATAGGTTATTAGAA CCTGGAACTTCTTCCAAATCCGTTGACATGTCTTCTCTTCCGAATTCCAAGCCTATTTCA AATTCAATGCCGGTTCCTGAGTCCAAGCTGGAGAGAAGGAAAAGTACCTCAGTTGTGGAG AACAGGCTTCATCGACCTCCAATAAAGCCAGCCCTCTATACTACTCCTGAGGCCACCCCA CTCCCTGATTCACCTACTTCCTTCCCTCCCTCGCCTTACATCATCAACCACAAGCGCCGA GGCCCTCGCCTTCTCAAGAGTTATTCCGAGCAGGATGTATCCATACACCAGAAGGCCGGA AATGAAGAGAAACTCAATGGGGATGTCAACAATGCAGAGCCCAAGTTGTCGAGTTCAACT GTGGATGATTCAGCTACTTTTACTTTTCCCAAGCCTGTTGAAGTGCAACATTCGAATGGC GTTCATCATTTTGAAAGCAGCAATGGGAAGCTTGGGACAAGTAATGGGAAACTTAGAAGC AGTAATGTGGAACTGGGTGGTAGTAGTGAGCGTGAAGATAGCTTCCATGAGTCGAAAAAG AGAAGCAGTAATGTGGAACTGGGTGGTAGTAGTGAGCGTGCAGATAGCTTCCATCAGTCG AAAAAGAGAAGCAGTAACGTGGAACTAAGTAAAGATTCGGATAGGGATGATGATTTGTGG AAGCAACCTGCGATGACTCCAGAAAGAGATAGTGACCGTGAAGATTTTTTTGATCCAAAA GACTCCATGAGTGTCTCAAGTTACACAGATGGAGAGGTAAATGCTGGGGCAGAGCGTTCT GCGCAGACAAGTACACCCATGGGGGAGTTCTATGATGCTTGGGATGAACTTTCATCTGAG AGTGGGCATGGGCAGCAGCTTTCCATTTCTGATGTTGAAGCTGAATTACGTGAAATGAGA TTGAGTCTTTTGATGGAAATAGAGAAGCGGAAGCAAGCAGAAGAATCCTTGAATAACTTG CGAAACCAGTGGCAGAGGATTAGGCAACATTTATCTCTTGTAGGATTGACACTCCCTGCA GATCCCACTGCTGCAGCAGGGCATGAGGAACTAGGTTCTGATCCTGCAGAAGAGTTGTGC CAACAAGTTCATCTTGCTAGGTTTGTATCAAATTCTATTGGAAGGGGCATAATAAGGGCT GAGATGGAGATGGAGATGGAAGCTCAGGTTGAGTCAAAGAACTTTGAGATTGCTCGGTTG GTGGACAAACTCCGTAATTATGAGGCTATGAATCAGGAAATGGTTCAGAGGAATCAGGAC GTTCTCGAGCTGGCACGGCGTGACAGGGAGAGAAGGGAAAGAAGACAGAGGTGGGTCTGG GGCTCGATTGCTGCTGCTTTAACTCTTGGTACTGCAGCCTTGGCATACTCTTATATCCCG TCTGGTAGGGGATCGCCAAACTACGATTCTGAGGCTACAGGAACATACAGGGTCAAACGA CGTCGCAACAAATTTATCCACTTGTGGAAGATAAAACAGAGTGGAAGAGTTATCAGAGAC ACTGGAGCTCCGACAATGGAGCTAACTCTACACATGTCCGCTTCTTTTTGCAGAGAGAAC TCTCTAACCCATTACTGCCACTCCAATTTCCTAACAACCCAAGAGTACCAAAAGACTCTT TTTCCTCATGTTACCAGAAAATCCCAATTGCAGCAGCCTAAGAATCGAATAAACAGGACT TCGAAACTTGTGGTTTCAACCACAAAACAACGGCTTTGGATTAGCGAACAACAGCAAGGC CAAGAAGAAGAAGAAGAAGCTGAAGATGATGAAGAAGAAGAGTACGCTTATTCGGAGGAC GAGTCATCATTGTTGTCTCTGAGTGAGAAGCCTGACAGGAGCATGGCTTTGCTCGATGAA TATGAGATAGAGGAGCTTGACTATGCCATCGACCCTAACCATAGAAGTGGGTATGTGGCT GTTCTGGGAAAGCCAAATGTGGGAAAGAGTACTCTTTCAAATCAAATGGTTGGTCAGAAG TTGTCCATAGTTACTGATAAACCTCAAACTACAAGGCATCGAATTCTTGGTATATGTTCT GGCACAGACTATCAGATGATACTTTATGATACACCAGGTGTTATCGAGAAGAAAATGCAC AAGTTGGATTCTATGATGATGAAAAATGTTCGCAGTGCTGTCATTAATGCAGATTGTGTA CTTGTTCTTGTTGATGCATGTAAAGTGCCTGAAAAAATCGATGAAGTGTTGGAAGAAGGT GTTGGTAACCAGGCAGATAGGTTGCCGCCCACTTTGCTGGTGATGAATAAGAAGGATTTG ATTAAACCTGGTGAAATTGCAAAGAAACTAGAGTGGTATGAGAAATTTACAAACGTTGAT GAGGTCATACCTGTGAGTGCTAAACATGGGCAGGGAGTGGAAGACGTCAAGCATTGGATT TTATCAAAACTTCCTTTTGGGCCAGCATATTATCCAAAGGACATTGTCAGTGAGCACCCA GAAAGATTCTTTGTATCTGAAATTGTTCGAGAAAAGATCTTTATGCAATACCGTAAAGAG ATTCCTTATGTGTGTCAGGTGAATGTCGTGAGCTACAAAACTAGGCCAACGGCAAAAGAT TTTATACAAGTGGAAATTGTCGTTGAAAAGAACTCGCAGAAGATCATTGTTATTGGCAAA GAAGGGAGAGCTCTGAAGCTACTTGCAACAGCTGCACGACTTGACATAGAAAATTTTTTA CAGAAGAAAGTTTTTCTGGAGGTTGAAGTGAAGGTTAAAGAGAACTGGCGGCAAGATGAA GTGCTTTTGAAGAATTATGGCTATGGAGGTCAAATTCAAGCATTATGA
PEP MEEGRAMPTFTVIALDRLLEPGTSSKSVDMSSLPNSKPISNSMPVPESKLERRKSTSVVE NRLHRPPIKPALYTTPEATPLPDSPTSFPPSPYIINHKRRGPRLLKSYSEQDVSIHQKAG NEEKLNGDVNNAEPKLSSSTVDDSATFTFPKPVEVQHSNGVHHFESSNGKLGTSNGKLRS SNVELGGSSEREDSFHESKKRSSNVELGGSSERADSFHQSKKRSSNVELSKDSDRDDDLW KQPAMTPERDSDREDFFDPKDSMSVSSYTDGEVNAGAERSAQTSTPMGEFYDAWDELSSE SGHGQQLSISDVEAELREMRLSLLMEIEKRKQAEESLNNLRNQWQRIRQHLSLVGLTLPA DPTAAAGHEELGSDPAEELCQQVHLARFVSNSIGRGIIRAEMEMEMEAQVESKNFEIARL VDKLRNYEAMNQEMVQRNQDVLELARRDRERRERRQRWVWGSIAAALTLGTAALAYSYIP SGRGSPNYDSEATGTYRVKRRRNKFIHLWKIKQSGRVIRDTGAPTMELTLHMSASFCREN SLTHYCHSNFLTTQEYQKTLFPHVTRKSQLQQPKNRINRTSKLVVSTTKQRLWISEQQQG QEEEEEAEDDEEEEYAYSEDESSLLSLSEKPDRSMALLDEYEIEELDYAIDPNHRSGYVA VLGKPNVGKSTLSNQMVGQKLSIVTDKPQTTRHRILGICSGTDYQMILYDTPGVIEKKMH KLDSMMMKNVRSAVINADCVLVLVDACKVPEKIDEVLEEGVGNQADRLPPTLLVMNKKDL IKPGEIAKKLEWYEKFTNVDEVIPVSAKHGQGVEDVKHWILSKLPFGPAYYPKDIVSEHP ERFFVSEIVREKIFMQYRKEIPYVCQVNVVSYKTRPTAKDFIQVEIVVEKNSQKIIVIGK EGRALKLLATAARLDIENFLQKKVFLEVEVKVKENWRQDEVLLKNYGYGGQIQAL


| Top |