Cherry SNP DataBase

Gene information

Gene Pav_sc0000103.1_g1290.1.mk
Chromosome name PAV_r1.0chr5
start 16570789
end 16574421
PAV_r1.0 name Pav_sc0000103.1
start 633333
end 636965
direction -
Annotation NR PREDICTED: putative phagocytic receptor 1b
Sequence CDS ATGGGGAAGACCATGACGGTGGGAGTGCCAGTCATCATCGCCTTGCTAATTCTGTGTGGT GTAGATCTGGTCAGGTCAGACGCGTCGGATCATCGGTACAAGGAAGGAGATTTAGTCCCT TTGTATGCCAACAAGGTGGGCCCCTTCCACAACCCCAGCGAAACCTACCGATATTTTGAT CTCCCATTCTGCTCACCAGATAAGGTGAAAGAGAAGAAGGAAGCTCTAGGTGAAGTATTA AATGGGGATCGTTTAGTCAGTGCCCCTTACAAACTAGAGTTCCAAAAGCATAAAGATTCA GAAGTAGCTTGTAAAAGAACAATCAAAAAGGAAGAAGTGGCCCGGTTCAGATCTGCTGTC AACAAGGACTATTACTTTCAGATGTATTATGATGACTTGCCCATTTGGGGTTTCATAGGG AAGGTTGACAAGGAAGGCAAAGACCCGAGTGAATACAAGACCTACCTGTATAAGCATATT CATTTTGATATCTCTTACAACAAGGACCGTGTGATTGAAATCAGTGTTCAAACAGATCGA AACGCACTGGTTGACCTTACAGAGGATAAAGAAGTTGATGTCGAATTCATGTATACTGTA AAATGGAAGGAAACAACCACTCCTTTTGATAAGAGGATGGATAAGTATTCTCAGTCCTCA TCGCTGCCGCATCATTTGGAGATCCATTGGTTCTCGATTATAAATTCATGTGTGACAGTT CTCCTCTTGACCGGGTTTCTTGCCACAATTCTCATGCGAGTGCTTAAGAATGATTTTGTC AAATATGCCCATGATGAAGAAGCAGCTGAAGACCAGGAAGAGACTGGATGGAAATACATT CATGGAGATGTATTTAGATTTCCCAAGTACAAGTCTCTGTTTGCAGCAGCTCTGGGTTCA GGCACCCAACTATTTACCCTTACAATATTCATTTTTATACTTGCTCTTGTTGGCGTGTTT TATCCATACAACCGAGGGGCTCTATTTACTGCTCTGGTTGTCATTTATGCACTCACATCA GGAATTGCAGGATATACTGCTACTTCATTTTATTGCCAGCTAGAGGGAACAAACTGGGTA TGTGATGATAAATTCCCCTGCTAG
PEP MGKTMTVGVPVIIALLILCGVDLVRSDASDHRYKEGDLVPLYANKVGPFHNPSETYRYFD LPFCSPDKVKEKKEALGEVLNGDRLVSAPYKLEFQKHKDSEVACKRTIKKEEVARFRSAV NKDYYFQMYYDDLPIWGFIGKVDKEGKDPSEYKTYLYKHIHFDISYNKDRVIEISVQTDR NALVDLTEDKEVDVEFMYTVKWKETTTPFDKRMDKYSQSSSLPHHLEIHWFSIINSCVTV LLLTGFLATILMRVLKNDFVKYAHDEEAAEDQEETGWKYIHGDVFRFPKYKSLFAAALGS GTQLFTLTIFIFILALVGVFYPYNRGALFTALVVIYALTSGIAGYTATSFYCQLEGTNWV CDDKFPC


| Top |