Cherry SNP DataBase

Gene information

Gene Pav_sc0000103.1_g1420.1.mk
Chromosome name PAV_r1.0chr5
start 16655372
end 16661374
PAV_r1.0 name Pav_sc0000103.1
start 717916
end 723918
direction +
Annotation NR PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform X1
Sequence CDS ATGCATTGTGCCCTTCAAAGAACTAACAGTGATATCCAGAAAAATTCAGACACTCGAAGA TATTCCTTATCAAAGAAAGAGCAAAAGAGTTTCAGAACATCTTTAGATGATTGTGAAGTG CCTTATGTCACAGGGAGGAACTCTGATCGTAGGTGTCCTATCCTTTCAGTGCTTTTCCGT GAACCTGACGGACATTGGAGAACTGTGGCACTGCCGCCACTATGTCCTGACAATATAAAT CACTTGGTATCTGGTACTCTGGTCAATATGGATACTCTGCATCTGGTTTACCCACCACCA ATTAATCCATTCAAGGTTAATCGACGAAAGGTGCAGAAGGGGCCTCCTCTTGATTTTACT TATTCTGTCAAGTCATTTACAGGTAGAAGGTTCACTGGTTCAGCTGTGCGCCACCAATCT CGAAATAAGACTTTGGCAAATAAAGCTACTAAATGGAATGAACTTTCCAGGAAATCTTTC CATAATGGCTGCAGTGATTCCTCAAGTACCATCCCAAATGGTTCTAACTCTATTAATTCC TCAACTATGAGCATTGGCAATAAAAAAATAAACAGCATTGCAAAAAGAAGTTCCAGAAAG AAGAGTAGAAAGAAGGGAAAACAGAGCACGAAGGTGTCTAATGAACCGGAAGTGTTGTCT GAGGAATATGCCAATGGAAGTTCAGCTTCTGAACCCTGTGGTAACAATGATGGGGACGGA CAAGTGTCGTCTTCAACTGCACCAGAAATTTCATTGCCAGATAGCGGCCCCAAGAATTCT GAAACACCAAACACATGCACCGCTTCCAGTGATGAGGTTGGTATTCCTTCTGTTGGCAAT TTTGAAAATCAGCTTCTACTTAAAGACTCTGGATTTCCCATCTTTGATGAGGTGGAGGGT ATTCATACACAGGTGAGCTGTTACAGTGATATGTATACCAAAGGTTACTCTGATATGCAT GACTCCTTCGTTTTGGATTCAATTTCATTTGGTTCAAACAGTGGTGATAGTACTAATGCT GGTCATGATGAAAAACACGCTGAGAAGGAAATTTTCAAGATAGATATTTCTAAACCTCCA GGTTTGAGTTCTGGGAAGGGACGTTTTTCTTGTCAAAGATTTTTAAATGATGTTGTAGAC AATTATGATCACACTGAGGAAGCAAGGCATGGTATTCAGGGTTGTCGCAGTAATGACATG CAATTGGTTGTGCCTAACAAGAGAAGTAAACAAAACAAAGTAGCACCGCGAACTGCAAAT GTCTCTAAATTTGGAAGTAATGGAAATCTGCATATTCGTATAGGAAAGGAAAACAATCAT TCTGTCTGGCAAAAAGTCCAGAGGAATGATTCCAGTGACTGCACTGGTGAGTTGAAAAAA GCAAGTTCTGTTTACTCACGGCTTGATCTCCCTTTGAGAGAGGCTCCCTTGCTTAAAAGA ACCTCTAATGTTGCTGATGTAAATGCCTTTTCGAAGAGTGAGGATAAAAAGCAGCAAAAA GATAAGGTCTCTAAGAAATTGAAAAGAAAAACCATACCATCTTTGAAACAAGAATACAAT TTTTATTCCAGAAAGGGTTCGCATGCCAGCATTGGTGGCTTAGATGGTTGTGCGAAGGCC AGGATGGATCAGAATGATATATTGGATATCTCGTCTCAGTTGAAGGATAAGAAATCCTTA AGTCTTGTTTCAAGATCTTGTTCTCCGCCTAGCTGTCCAAGGGGTGGATATCAGAGCAGC AAAATAGAATGCATGACGTCTGGATCAGTTCACAACATGAAACTTTGTCAAAATGAAATG GATCATTTTGAAAGTGTCTGTGTAGGAAACAAGAATAGCTCAGTGCAAAGAAAATGGGAT TCCTTGAGTGAATCAAATCTGCTTCAGGTGCAGTCTCCAGTCTACCTTCCTCATTTACTT TGTAATGCAACAAGTCAAGAAGTACAGAAAGAAGTTTCTCTTGCGGAAAGCATCAGGCAA AACTCTAGTAGTTCTGGATCTCTTACACACAAGTGGATGCCAATTGGGTCGAAGAATGCT GGGTTGACAAGCTCTACTAGATCTGGCAGTTCATCTCTTGAACATTCTGATGAGGCTGCT TCTAAGAGATGGGCTCTTAAAGACACTGCTAAAGGGAATGTGGTGTCCAATACTCAAAAT CTAGTTTCTAAAGTTGCAGTAGGGTGCACGGGTCAGAATTCTGAAGACGTAACCTGTTCT TCTGATGCAATTGATGGAAGGCTTCCAAAATCAAGCACAATTGAAGATCTGGCCAATAAC AAGCTTGATGTAGCGAACTGCATCAATGATTCTGCAGTATCCAAAGATCTCAATGTATTT GAAGCAGAGTCAAACAGAATACTAGAAGCAGTGAATAATGCTCGTAGGGCACAATCGGCA TCCGAAGCTGTTCAAATGGCCACTGGCCGTCCAATTGCTGAATTTGAACGACTTCTTTAT TATTCCTCCCCTGTTATCCATCAATCGCCCAATTCTATAAGTTGTCATACTTGCTGCTCA AGGAACCAGGTGGATCAGGTTGGTGGTGTGTCATTGTGCAGACATGAGACACCTCACATC ACTTTAGGATGCCTATGGCAGTGGTATGAGAAATATGGTAGTTATGGGCTGGAAATAAGG GCAGAGGAATTTGGAAATTCAAAGAGGTTGGGTGCTGATCATTTTGCATTTCGTGCTTAT TTTGTCCCCTATTTGTCAGGAATTCAGCTTTTCAGGAACGGTAGAAGTACTGATTCTGTA AATATTAACAATAGGCTTCATAGTTCTCAGGAGTTAAGCACATGCAGGATCAGTAAGACA CCCAAAAAATCCTCTAGCATTGGTAGTCTTCCAATATTTTCAGTACTTTTTCCTCAGCCT GATCACAAGGAACATGCAGTAACCCCACCACTTGTAAATCAATTGTGTATTTCAGAACAA TCTTCAGCTTCTGCCAAAGATGTATCTGCTCAATTAGCTGACACAACAGGGTCCAGTGAT TTAGAGCTACTATTTGAATATTTTGAATTAGAACAACCTCAGGAGAGACGACCTTTATAT GACAAGATAAAGGAGCTTGTTAGAGGTGATGGACTGTCACATTCCAAAGTATATGGAGAT CCAACTAAACTAGACTCTATAAATCTAAATGATCTGCATCCCAGATCCTGGTACTCAGTG GCATGGTATCCTATTTACAGGATACCTGATGGTAACTTCCGTGCGGCATTTCTAACTTAC CATTCACTTGGTCATTTGGTCCATAGACGTGCCAAATTTGAGTCTCGTAATGTTGACCCT TGTATAGTATCTCCAGTTGTAGGTCTTCGAAGTTACAATGCTCAGGATGAATGCTGGTTC CAGCTAAGGCCCTCAACGCCGAGGCAGACAACAGTAACACCGGGCTTAAACCCTTGTGGA GTACTAGAAGAGCGTTTGAGGACACTTGAGGAGACAGCATCTCTTATGGCAAGAGCTGTT GTGAACAAAGGAAGTATGACATCTGTAAACAGGCATCCGGACTATGAATTCTTCCTCTCC AGGCGACGCTGGTGA
PEP MHCALQRTNSDIQKNSDTRRYSLSKKEQKSFRTSLDDCEVPYVTGRNSDRRCPILSVLFR EPDGHWRTVALPPLCPDNINHLVSGTLVNMDTLHLVYPPPINPFKVNRRKVQKGPPLDFT YSVKSFTGRRFTGSAVRHQSRNKTLANKATKWNELSRKSFHNGCSDSSSTIPNGSNSINS STMSIGNKKINSIAKRSSRKKSRKKGKQSTKVSNEPEVLSEEYANGSSASEPCGNNDGDG QVSSSTAPEISLPDSGPKNSETPNTCTASSDEVGIPSVGNFENQLLLKDSGFPIFDEVEG IHTQVSCYSDMYTKGYSDMHDSFVLDSISFGSNSGDSTNAGHDEKHAEKEIFKIDISKPP GLSSGKGRFSCQRFLNDVVDNYDHTEEARHGIQGCRSNDMQLVVPNKRSKQNKVAPRTAN VSKFGSNGNLHIRIGKENNHSVWQKVQRNDSSDCTGELKKASSVYSRLDLPLREAPLLKR TSNVADVNAFSKSEDKKQQKDKVSKKLKRKTIPSLKQEYNFYSRKGSHASIGGLDGCAKA RMDQNDILDISSQLKDKKSLSLVSRSCSPPSCPRGGYQSSKIECMTSGSVHNMKLCQNEM DHFESVCVGNKNSSVQRKWDSLSESNLLQVQSPVYLPHLLCNATSQEVQKEVSLAESIRQ NSSSSGSLTHKWMPIGSKNAGLTSSTRSGSSSLEHSDEAASKRWALKDTAKGNVVSNTQN LVSKVAVGCTGQNSEDVTCSSDAIDGRLPKSSTIEDLANNKLDVANCINDSAVSKDLNVF EAESNRILEAVNNARRAQSASEAVQMATGRPIAEFERLLYYSSPVIHQSPNSISCHTCCS RNQVDQVGGVSLCRHETPHITLGCLWQWYEKYGSYGLEIRAEEFGNSKRLGADHFAFRAY FVPYLSGIQLFRNGRSTDSVNINNRLHSSQELSTCRISKTPKKSSSIGSLPIFSVLFPQP DHKEHAVTPPLVNQLCISEQSSASAKDVSAQLADTTGSSDLELLFEYFELEQPQERRPLY DKIKELVRGDGLSHSKVYGDPTKLDSINLNDLHPRSWYSVAWYPIYRIPDGNFRAAFLTY HSLGHLVHRRAKFESRNVDPCIVSPVVGLRSYNAQDECWFQLRPSTPRQTTVTPGLNPCG VLEERLRTLEETASLMARAVVNKGSMTSVNRHPDYEFFLSRRRW


| Top |