Cherry SNP DataBase

Gene information

Gene Pav_sc0000103.1_g220.1.mk
Chromosome name PAV_r1.0chr5
start 16027609
end 16032751
PAV_r1.0 name Pav_sc0000103.1
start 90153
end 95295
direction -
Annotation NR PREDICTED: uncharacterized protein LOC103338739
Sequence CDS ATGTTGAAGTATGATTCCATACTTGCCAGAAGTTTCAGTCGGCATGAGCAGAAGAAATTG AGATATGGAGCATTTGTTTGCTGCTTGCTCATGGCATTGTGCTTCTGCACAGTGCTCAAG CCTAATTTGAATCCTCTACCAGCTTTGAAATTGCAGCGGTCAATGGGGGTCAAACACAAG ATACTGGCACTCTGGGAAACAAACAGCACTCAGCAAGTAATTAAAAACATGCTTGAATAT CCGGAGATAAGCACAAACACGACGGAGGAGTTTGAAAATGTGACTTCTCAAGTAGCAGCA GATTCTGATGATCTGCAGCAAAACGCAAGCACTCTCACTAATCCCATTGCAAGCAGCAGT CAGGCTGAAGAGGCAAAGATTGAAGAAGTGGTGACAAAGAATTTAGGGCCACTTTGCAAC ACCATGGAAGCAAAAACTGAATTTTGCGAGATCAACAAGGATGTTCGTGTCGATGCGAAA TCTTCGTCAGCGTTTGTTGTTTCATCTCAAATTGGGAATAGGCCCTGGAGTATAAGACCA TATGCTCGAAAAGAAGACGAATTGGCGATGAGCCATACTCGAGCATGGTCAGTGAAACCA GTCATTGGTGATCTGGAAATCCCTCAATGTAACCGAAATCATAGAGTTCCTGCCATCTTG TTTTCAAATGGTGGATATACAGGAAACCATTTCCATGAGTTCACTGATGTGGTGATCCCT CTCTTTATCACTTCTAGAAAATATGATGGAGAAGTTCAATTTCTTATTTCGGATATAAAA CCTTTTTGGGTAACAAAGTACCAAGCAGTACTAAAAGGACTGTCCAAGTATGACATTATC GACATCGACAAAGAAGATGTTGTGCATTGCTTCCCAAGCCTAACGGTTGGCCTTAAAAGA CATGAAAAGGAGCTGAGCATTGACCCTTCAAAACATTCATATTCTATGAAAGACTTCAGA GAGTTTCTAAGAAACAGTTTCTCATTGAAGAAAGCCAATGCAATCAGAATCAAAGATGGT CATCAACGAAAAAGGCCCCGGCTTCTGATCATACCAAGAAAGAGAACAAGGTCGTTCACA AATACAGGGGAAATTTCTAAAATGGCTAGACGCTTGGGATTCAAGGTGATTGTTGCAGAG GCTGACATTAACTTGTCAAAATTTGCAGAAGTTGTCAATTCTTGTGATGTGTTAATGGGA GTTCATGGAGCTGGCCTTACAAACATTCTTTTCCTTCCTGAGAATGCAGTTTTCATTCAA ATACTTCCCGTTGGAGGGTTCGAATGGCTCGCAACGAACGACTTTGGCGAGCCTTCACAG GATATGAATCTCAAGTATTTGGAATATAAGATAAGCAATGAGGAGAGCACGTTGATACAG CAATACCCACTGGATCATGCTGTTTTCACTGACCCTTACTCAATTGGAAAACAGGGGTGG GAAGCATTCAGAGACTACGTCGGACCATCTACATCGGAGATTATGAAATTTCGCTGCAAA ATTGACGACATGGGAGGCCGAGATGGACCAAAGCTTCGAAGATTGGGGTTTCTGGCGAGG CGAGCATACGAACCGTCGTCGTCGCCCTTGGTGTTCGCATCACGACGATCTCCGAGAAAT TTGCATGAAATTTTCGAAAGCGTAGCATCGAAGAAATTTGTGCATACGAACCGTCGTCGT CGGCCTTAG
PEP MLKYDSILARSFSRHEQKKLRYGAFVCCLLMALCFCTVLKPNLNPLPALKLQRSMGVKHK ILALWETNSTQQVIKNMLEYPEISTNTTEEFENVTSQVAADSDDLQQNASTLTNPIASSS QAEEAKIEEVVTKNLGPLCNTMEAKTEFCEINKDVRVDAKSSSAFVVSSQIGNRPWSIRP YARKEDELAMSHTRAWSVKPVIGDLEIPQCNRNHRVPAILFSNGGYTGNHFHEFTDVVIP LFITSRKYDGEVQFLISDIKPFWVTKYQAVLKGLSKYDIIDIDKEDVVHCFPSLTVGLKR HEKELSIDPSKHSYSMKDFREFLRNSFSLKKANAIRIKDGHQRKRPRLLIIPRKRTRSFT NTGEISKMARRLGFKVIVAEADINLSKFAEVVNSCDVLMGVHGAGLTNILFLPENAVFIQ ILPVGGFEWLATNDFGEPSQDMNLKYLEYKISNEESTLIQQYPLDHAVFTDPYSIGKQGW EAFRDYVGPSTSEIMKFRCKIDDMGGRDGPKLRRLGFLARRAYEPSSSPLVFASRRSPRN LHEIFESVASKKFVHTNRRRRP


| Top |