Cherry SNP DataBase

Gene information

Gene Pav_sc0000107.1_g020.1.mk
Chromosome name PAV_r1.0chr5
start 7471100
end 7477284
PAV_r1.0 name Pav_sc0000107.1
start 13099
end 19283
direction -
Annotation NR PREDICTED: YTH domain-containing protein 1
Sequence CDS ATGTCTTGTGATACTGCAAAAGAGAATGCATCTGTAGTTGACTCATCTGTTACTGAATGG AAACAAGACATGGGAAACTCAGATGATCCAGAGAGTTCAAGTCACAAAGTTAATGAGGAG GGTAATCCATCTAAGTCAGAAGAAGGGGGCAATTGTCATGATCAGGGTGGAAAAACAACT GGAAGAAAAAAGGGTACTTTGTATGATACAAGATATTTCATCATTAAGAGTTTGAATCAT CAAAATATCCAACTATCAATTGAGAAAGGAATTTGGGCTACTCAAGTCATGAATGAACCA ATTTTGGAAGAGGCCTTTCATAATTCTGGTAAAGTAATTTTAATATTCAGTGTCAACATG AGTGGTTCCTTCCAAGGGTATGCCCAAATGATGTCTTCTGTTGGATGGAGGCGAGACAAT GTATGGAGTCAAGGAAGTAGTAGAAGTAATCCATGGGGGCGCAGTTTTAAGGTCAAATGG CTGCGGTTAAATGATCTGCCTTTCCAAAAGACTCTTCATCTCAAGAATCCATTGAACGAG TACAAACCTGTTAAAATTAGCAGAGACTGCCAGGAGTTATCTCCAGATGTTGGAGAAGCT CTTTGTGAGCTTCTTGATGGGACAAATGATGTGAATGGACTGAATAGTATTGCAATGGAT GATTTTCCATCAAAAAGGCCTTGTATAGAGCCTCCATGTTCATTAGGTGAGGAAGAGTAT AATGTAGGCCCCATGCATCTCTCATGGTCCCAGACACCCATGCACTATCCCTCCTTGCTT TACCAACATCAGGCCGAAGCAAATTTGCCTGTCAACTCTGTGGCATCAAAAGTTACAAGG GCAAAACATTCTCGCATTAATGGATACCATTCTAATATACGAGTGGACAGGGATTTGTCA TCTCGGTTTGATGTTTGGGGTTTGTCTGCAGAAAGCCGTCTAGCAAGTGTTCTTACTGAG GATGATTTTCTGGAAATGTCTTATGAAGAATACCTGGAGGCCCAAAGTAGAAGTAGCAAG GCATTATGTCTGCCTGTCAAAGCTCAAGCTATGGAATTGACCGCAGCTGCTCAAGGAAAA GGGCTCACCATTCATCCCATAAGAAATCACAATGCTAACACAGCTGTGACTTCCCTTGGT CGTTTTTGGATAATAGCTTTGTCATCTGATGGAGTTTTGCATTTCCTTCAGGCAATCATT CAGTGA
PEP MSCDTAKENASVVDSSVTEWKQDMGNSDDPESSSHKVNEEGNPSKSEEGGNCHDQGGKTT GRKKGTLYDTRYFIIKSLNHQNIQLSIEKGIWATQVMNEPILEEAFHNSGKVILIFSVNM SGSFQGYAQMMSSVGWRRDNVWSQGSSRSNPWGRSFKVKWLRLNDLPFQKTLHLKNPLNE YKPVKISRDCQELSPDVGEALCELLDGTNDVNGLNSIAMDDFPSKRPCIEPPCSLGEEEY NVGPMHLSWSQTPMHYPSLLYQHQAEANLPVNSVASKVTRAKHSRINGYHSNIRVDRDLS SRFDVWGLSAESRLASVLTEDDFLEMSYEEYLEAQSRSSKALCLPVKAQAMELTAAAQGK GLTIHPIRNHNANTAVTSLGRFWIIALSSDGVLHFLQAIIQ


| Top |