Cherry SNP DataBase

Gene information

Gene Pav_sc0000113.1_g270.1.mk
Chromosome name PAV_r1.0chr7
start 15004969
end 15010973
PAV_r1.0 name Pav_sc0000113.1
start 116505
end 122509
direction +
Annotation NR PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.6-like
Sequence CDS ATGGTGGTAAGTGTGCAGACCACCATGAACAAAGCCTTGTTGCTTATGCTATTTATGGTT TTCTATAATGGTGCTTCTTCAAATGGACTTGGTGTTGGTGCTACTATTACTACTGCAAGA CCTGACGTTGTCAACATAGGCGCGATTTTCACTTTCGATTCTGTCATTGGCAAAATTGCA AAAGTTGCAATAGCCCTTGCAGTCGAAGATGTCAATTCTGATCCACAAATTCTCAATGGA ACAAAGCTGACACTTAAAATGCAGAATACCAAATCTAGTGACTTTCTGGGCATCATTGAG GCTTTGCAGTTCATGGAGAATGACACAGTGGCCATAATTGGCCCCCAATTCTCAGCTACT GCTCATGTAATCTCACATATTGCAGATGAGCTAAAAGTCCCACTATTATCATTTGCAGCA ACAGACCCTACTCTGTCTCCAACTCAGTTCCCATTCTTGGTTAGGACAACAAGAAGTGAC CTCTTTCAGATGACTGCAGTAGCAGACCTTGTTGGCTACTATGAGTGGAGAGATGTCATA GCAATATATGTGAATGATGATTTTGGCAGAAATGCCATTGCTGCCTTAGGGGACAAGCTA TACGAAAAACGGTGTAAAATTTCATACAAAGTGCCTCTGAACCCCAAAGCAACAAAAGAT GAAATCACCAAGGCACTGGTTAGTGTTTCTTCAATGGAGTCCAGGATTCTGATACTGCAC ATTTATACCAGTTGGGGTCTACAAGTGCTTACTGAAGCACGAAACCTCATGATGATGGCC AGTGGATATGTCTGGATTGCTACTGATTGGTTCTCTACCATAATAGATACAGATCCTTCC CTGCCTTTTGTATCAACAGATGACATTCAAGGGGTTCTTACATTAAAAATGTACACACCA GAATCGGAGCTCAAAAAGAAATTTAAATCGCGGTGGAGCAACTTAACTAGCGCAAGAAGA GTGAATGGCTCTTCTTTTGGGCTAAATACGTATGGTCTATATGCCTATGATTCTGTAAGG CATCTTGCTGTTGCCCTTGATTCATTTTTTGCTCGAGGGGGAAATATTTCATTTTCAACT GACTCGAACTTAAACGAGTTACGCGGAGGGAAGTTGAATCTTGATGCTTTGAACATGTTC AATGGTGGCAGCCAGCTGCTCCAAAGCATTTTAGAGGTTAACACAACTGGTTTAACTGGG CCAATTAAGTTTAATCCAGATGGGAACTTGATTAATCCTGCATTTGAAGTCATCAATGTG ATTGGCACAGGGACTAGGACAATTGGTTATTGGTCCAACTCTTCTGGCTTATCACTTGAT CCACCAGAAAAACCTCAAAGGAAGCTGCAGTCTAATGGCTCCAGCATCGGTATTCAACGA CTATACAGCGTCATCTGGCCTGGACAAACAACTCAGAAGCCACGCGGCTGGGTGTTCCCT GACAACGGAAGAAAGCTCAGGATTGGTGTCCCAAATCGAGTTAGCTGTCGTGAGTTTGTG GGCGTAAAAGGCACAGAATTCACTGGCTATTGCATTGAGGTCTTTCAAGCTGCATTGAAT GAGTTACCATATGGTGTCCCATATAAATTTGTCCCCTTTGGGGATGGTAAAAAGAACCCA GATAACAATGAACTTCTGCACATGATCCAAATTGGTGAGTTTGATGGTGTGGTTGGAGAT ATTACCATCACCACTAGCAGAACAAAGATGGTGGATTTTACACAGCCATATATTGAGTCT GGTTTAGTTGTGGTTGCTCCAATAAGGAAGTTGAACTCTAGTGCTTGGGCTTTTCTGAGA CCTTTCACTCCAATGATGTGGGGTGTCACAGGCATTTTCTTCCTAGTTGTTGGAACAGTA GTTTGGATTTTGGAGCGTAGGACAAATGAGGATTTTCGGGGCCCTCCAAGAAACCAATTT GTCACAATTATTTGGTTTAGCTTTTCAACTTTGTTCTTTTCCCAGAAAGAAAAAACTGAC AGCACGCTTGGTCGGTTTGTGCTAATCATATGGCTATTTGTAGTTCTAATAATCAACTCA AGCTACACTGCAAGCCTGACCTCAATCCTTACAGTGGAGCAGCTTTCTTCCCCCATTAAA GGCATTGAAAGTTTAGCAACAGGCAATGATCCCATTGGTTTCCCAAACGGTTCCTATGTT GGAAAATATTTGACAGACGAGCTAAACATACACAGTTCAAGACTTGTTCCCCTTAACTTA CCAGAAGAATTTGAGAAGGCCTTAAAAGACGGGCCCAGCGCAGGTGGTGTTGCTGCAGTG GTTCACGAGCGTGCGTACATGGAGCTCTTCCTCTCTGTTCGATGCGGATATAGTATTGTA GGTCAAGAATTCACGAAAATGGGGTGGGGATTTGCCTTTCCAAGGGACTCACCACTAGCA ACTGACATGTCAACCGCGGTGTTGAAACTGTCAGAGAAGGGGGATCTCCAAAAGATTCGT GACAAGTGGCTGATGAAAAGTGCTTGCAGTGCACAAGGAGCAAAGCAATCGGTAGACCGC CTGCCACTGAAAAGCTTTTGGGGTCTCTTTCTGCTAAGCGGCATAGCTTGCTTTCTTGCT CTCCTTCTTCATGTTATTCGCCTTGTGCACCAATTCTACAGGTATTCAGATTCATGCTGT GAGAGCCCACAGTCTAGACGTCTTCGATCATTTGTTTCATTTGCAAATAAAAGGGAACAA GAAGTGAATAGCCGACCCAAGAGAAGGAGGACTGAGAAAGCTTCAACCAAAATAGTGCAT GAAAGTGTTTAA
PEP MVVSVQTTMNKALLLMLFMVFYNGASSNGLGVGATITTARPDVVNIGAIFTFDSVIGKIA KVAIALAVEDVNSDPQILNGTKLTLKMQNTKSSDFLGIIEALQFMENDTVAIIGPQFSAT AHVISHIADELKVPLLSFAATDPTLSPTQFPFLVRTTRSDLFQMTAVADLVGYYEWRDVI AIYVNDDFGRNAIAALGDKLYEKRCKISYKVPLNPKATKDEITKALVSVSSMESRILILH IYTSWGLQVLTEARNLMMMASGYVWIATDWFSTIIDTDPSLPFVSTDDIQGVLTLKMYTP ESELKKKFKSRWSNLTSARRVNGSSFGLNTYGLYAYDSVRHLAVALDSFFARGGNISFST DSNLNELRGGKLNLDALNMFNGGSQLLQSILEVNTTGLTGPIKFNPDGNLINPAFEVINV IGTGTRTIGYWSNSSGLSLDPPEKPQRKLQSNGSSIGIQRLYSVIWPGQTTQKPRGWVFP DNGRKLRIGVPNRVSCREFVGVKGTEFTGYCIEVFQAALNELPYGVPYKFVPFGDGKKNP DNNELLHMIQIGEFDGVVGDITITTSRTKMVDFTQPYIESGLVVVAPIRKLNSSAWAFLR PFTPMMWGVTGIFFLVVGTVVWILERRTNEDFRGPPRNQFVTIIWFSFSTLFFSQKEKTD STLGRFVLIIWLFVVLIINSSYTASLTSILTVEQLSSPIKGIESLATGNDPIGFPNGSYV GKYLTDELNIHSSRLVPLNLPEEFEKALKDGPSAGGVAAVVHERAYMELFLSVRCGYSIV GQEFTKMGWGFAFPRDSPLATDMSTAVLKLSEKGDLQKIRDKWLMKSACSAQGAKQSVDR LPLKSFWGLFLLSGIACFLALLLHVIRLVHQFYRYSDSCCESPQSRRLRSFVSFANKREQ EVNSRPKRRRTEKASTKIVHESV


| Top |