Cherry SNP DataBase

Gene information

Gene Pav_sc0000113.1_g490.1.mk
Chromosome name PAV_r1.0chr7
start 15142427
end 15178103
PAV_r1.0 name Pav_sc0000113.1
start 253963
end 289639
direction +
Annotation NR PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like
Sequence CDS ATGTCTCAGATTTTTAAGATGAGCTTGTGGAACTATAAGCCTGATGTGATGGATGCATTG ATTGAATTCATTGAATCCTTGACTCTTAGTCTTGTGATATACGTAGAGAACATGTTGAAG TTGGAGAGTGGCATGCTTGGAGAAGTTGTTCGGATCCCAATGCTTGCTGGTGTTGTGGAT TTGCTGCTAGACCTGGATGTGGAGATTGGATGGGAAGACATAAAAAATGATTCTAGTAAA GGAATATTTGAGATGGAGCTAGAAGATGTGGATGAGTCCAGAGATGATGATCTGAATGAT GATAGTGAGATCTTTGATACTCTTCTCGAGTCATTTAAGAAGACTGTTTTGACTGCATAC AAATCAAAATTTGCCCAGAATGAGTGCCGTTGCTTATCTTGCTAG
PEP MSQIFKMSLWNYKPDVMDALIEFIESLTLSLVIYVENMLKLESGMLGEVVRIPMLAGVVD LLLDLDVEIGWEDIKNDSSKGIFEMELEDVDESRDDDLNDDSEIFDTLLESFKKTVLTAY KSKFAQNECRCLSC


| Top |