Cherry SNP DataBase

Gene information

Gene Pav_sc0000129.1_g1290.1.mk
Chromosome name PAV_r1.0chr7
start 15751277
end 15754298
PAV_r1.0 name Pav_sc0000129.1
start 633536
end 636557
direction -
Annotation NR PREDICTED: methylthioribose-1-phosphate isomerase
Sequence CDS ATGGCCCCTAACTCGGAGTTCACAGACGGCGCCGAAGCGGCCAACTCTCTCCAGTCTATC TGCTACAAGCGTGGCTCGCTTCAGCTACTCGATCAGAGGAAGCTACCTCTGCAAACTACA TACTTGGATATCCGAGACTCCACAGATGGATGGCATGCGATCAAAGATATGGTGGTGCGC GGTGCGCCTGCCATTGCCATTGCCGCAGCTCTGTCTTTGGCTGTAGAAGTGTTTAACTTG GAGGATTTCAATGGAACACCCGATGAAGCGTTTTCTTTCATTGTAATGAAATTGGAATAT CTGGTCTCCAGCCGACCAACTGCTGTCAATCTTTCAGATGCTGCAGCTAAACTAAAACAA ATTGCATCCACGGTAGCTGCTGCAACTTCGGATGCGAAGAATGTGTTTGAGGCTTTTATA GAAGCTTCTGAAATTATGCTCGAGGACGATGTTGCTTCAAACAAGGCTATTGGGACTTAT GGAGCAAGTTTCATTCAGCACCTACTGGAAAACTCTAAGAGCATTTCTATGTTGACCCAT TGCAACACTGGCAGTCTTGCAACAGCTGGTTATGGTACTGCCCTTGGTGTTATACGTTCA CTTCATACTGAAGGAGTGTTAGAAAGGGCCTATTGTACAGAGACACGCCCATTCAACCAA GGATCCAGACTTACAGCATTTGAGTTGGTGCATGATAACATACCTGCCACTCTTGTAGCA GATTCGGCTGCAGCTGCATTAATGAAAGATGGACGTGTGAATGCTGTAATTGTTGGAGCA GATCGTGTTGCAGCAAATGGTGACACTGCGAACAAGATTGGGACCTACAGTCTTGCCGTA AGCGCAAAGTACCATAACATTCCATTTTTTGTCGCTGCACCACTCACTTCCGTCGACTTA TCTCTTTCTTCTGGACAAGAGATAATAATAGAGGAAAGATCTCCAAAGGAATTGTTGCAC TCACAGGGGGGACTCGGGGAACAAGTTGCTGCATCTGGAATCTCCGTCTGGAACCCAGCG TTTGATGTTACCCCTGCTAATCTGATTGCCGGCATCATAACAGAGAAGGGTGTCATAACA AAAAAGGGCACCGATGCTTTCGACATAAAGGGTTTTGTTCAGAAGGCAGCCTTGCAGTCC GGTGCATAG
PEP MAPNSEFTDGAEAANSLQSICYKRGSLQLLDQRKLPLQTTYLDIRDSTDGWHAIKDMVVR GAPAIAIAAALSLAVEVFNLEDFNGTPDEAFSFIVMKLEYLVSSRPTAVNLSDAAAKLKQ IASTVAAATSDAKNVFEAFIEASEIMLEDDVASNKAIGTYGASFIQHLLENSKSISMLTH CNTGSLATAGYGTALGVIRSLHTEGVLERAYCTETRPFNQGSRLTAFELVHDNIPATLVA DSAAAALMKDGRVNAVIVGADRVAANGDTANKIGTYSLAVSAKYHNIPFFVAAPLTSVDL SLSSGQEIIIEERSPKELLHSQGGLGEQVAASGISVWNPAFDVTPANLIAGIITEKGVIT KKGTDAFDIKGFVQKAALQSGA


| Top |