Cherry SNP DataBase

Gene information

Gene Pav_sc0000130.1_g930.1.mk
Chromosome name PAV_r1.0chr8
start 20321237
end 20330038
PAV_r1.0 name Pav_sc0000130.1
start 439319
end 448120
direction +
Annotation NR PREDICTED: uncharacterized protein At5g01610-like
Sequence CDS ATGGATGGGTGTTTTGAGGGGTTAGGAGATCCAGCAAGGGTGAAAACTTTTGTCTCAAGA AAAATTATAATTGGCCTGCTGACAGGAGTAACAGGCTACGAGCTAGACAGGGACACCGGC AATTTCAAGGCGTATTTCAACGGAACCTGCAGCTTCTCCCTTGAAAACTCGTATCAGCTC AGGTACAGATCCACCATAACTGGTGTTTTGTCCAAAGACAGGCTCAAAAATTTGAAGGGC GTGAGTGTGAAGGTGCTCTTCTTCTGGATCGACATAGTGGAAGTGGTTCGAAATGGCGAT GAGCTACAATTCTCCGTGGGGATTGTTTCAGCCGACTTTTCAATCGACAACTTTGAGGAG AGCCCGCAGTGTGGCTGTGGATTTGCTTGTCAACAGTTGGTGAGTAGCGGCGCCGTGCCA TCACATTCGGTGAGAGCACTTATCAATCAAAACTTCATCAACCATGTCTCCAAAGGAAAC ACTGCTCTGCCTATCTCTCTTCCTTCTGGTCTCCTTCTCAACCCCATCTGCATCTGTCAA CGACGAGCTGACAGTAAGTTCTCAGTCTACTTGAATGGCACTTGTACCTTTTCCATTGAC TCCTATAAGTTGAAGTACAAGTCCACCATAACCGGTGTGATAACGGATGACAAGATCTCG AGCTTGAGTGGCATCAAAGTGAAGGTGCTCTTTCTGTGGCTGAGCATCGTCAAGGTGATT CGTGACGACGATGAGCTCGAGTTCTCTGTGGGCATCGGCTCCGCGGACTTTCCGGTCAGT AATTTCGTTGAGAGCCCAACCTGTGGTTGCGGTTTTGATTGTGTCAATGGGAAGGGAAGC AAGATTAAGATCAATAATTTAGTAAAAGTCCCCACGTCCTTTGCCAAGCCAACAGCACGT GACTACCTAAAAGAAGACAAACTCATCCATACGTCGCCGTTTTTGAAGAACTATTATTGT CGTATTCAGACTGTATACGTCGTCTCCACCGCTAGAGAAGCGAGAGAAAATCCGAAAGCC CAAACCATGTCGTCTCTCGCAGCCATTCTCGCCCTCTTCGTCATCCTATCCCCGTTCGCT ACGTCATCAACGGCCGCCGCCGGCAACGATAACTCACGGTCGGCGTACGATATCATCCAA GACTTCGACTTACCGATGGGTCTGCTCCCGAAGGGCGTCACTGGTTACGAACTGGACCGA AGCAACGGTCAATTCCGAGCTTATTTGAACGGTTCCTGCAGTTTCGCATTGGAAGGGTCG TACCAGCTCAAGTATAAGTCCACCATCAGTGGCTCTATCTCCAAGAACAGGCTCTCTGGG CTCACTGGGGTTAGCGTCAAGGTCTTGTTCTTGTGGCTCAACATCGTCGAGGTCACTCGG AGCGGCGACAATCTTGAATTCTCTGTGGGGATCGCTTCTGCTGCGTTTCCGATTGACAAC TTTTACGAGTGCCCACAGTGCGGGTGTGGATTGGATTGCGTCAATGGGCAAGTAAGGAAA ATTAAAATGAACCCTCTTGTTTCTTCAATTTGA
PEP MDGCFEGLGDPARVKTFVSRKIIIGLLTGVTGYELDRDTGNFKAYFNGTCSFSLENSYQL RYRSTITGVLSKDRLKNLKGVSVKVLFFWIDIVEVVRNGDELQFSVGIVSADFSIDNFEE SPQCGCGFACQQLVSSGAVPSHSVRALINQNFINHVSKGNTALPISLPSGLLLNPICICQ RRADSKFSVYLNGTCTFSIDSYKLKYKSTITGVITDDKISSLSGIKVKVLFLWLSIVKVI RDDDELEFSVGIGSADFPVSNFVESPTCGCGFDCVNGKGSKIKINNLVKVPTSFAKPTAR DYLKEDKLIHTSPFLKNYYCRIQTVYVVSTAREARENPKAQTMSSLAAILALFVILSPFA TSSTAAAGNDNSRSAYDIIQDFDLPMGLLPKGVTGYELDRSNGQFRAYLNGSCSFALEGS YQLKYKSTISGSISKNRLSGLTGVSVKVLFLWLNIVEVTRSGDNLEFSVGIASAAFPIDN FYECPQCGCGLDCVNGQVRKIKMNPLVSSI


| Top |