Cherry SNP DataBase

Gene information

Gene Pav_sc0000131.1_g250.1.mk
Chromosome name PAV_r1.0chr1
start 30278939
end 30280948
PAV_r1.0 name Pav_sc0000131.1
start 149221
end 151230
direction +
Annotation NR PREDICTED: serine/threonine-protein kinase At5g01020
Sequence CDS ATGGCTCATGAGAAGATCACATGGAAATGCATCATCCCAGGCTGTTACAAAAGCGCTGCA CGTTTAGAAAACCGGTTGCAGACAGATTGCAAAAGAGCACAAATTCTAAAACAAAACCCT TTGCTGCAGAAGAGGCTTTCCCTCTCGGATATAAACGATGATCCCAGCTCAACGCTCTTT GCAGATGATCTTTCCAACTCTGTCATCGGCCTTAATCTTCATGTTTTTTCGTTAGCGGAG CTTCGAGTTGTCACAAGTAATTTCTCATGGAGTAATCTGCTTGGTGAGGGCGGGTTTGGA CCGGTGTTCAAGGGGTTTATTGATGACAAGCTTAGGCCTGGATTGAAGCCTCAGCCTGTA GCTGTCAAACTGTTAGACTTGGATGGCTTGCAGGGCCATAGGGAGTGGCTGGCTATTCTT CTGCTCTGCCGTGGTCGAAAAGAATGA
PEP MAHEKITWKCIIPGCYKSAARLENRLQTDCKRAQILKQNPLLQKRLSLSDINDDPSSTLF ADDLSNSVIGLNLHVFSLAELRVVTSNFSWSNLLGEGGFGPVFKGFIDDKLRPGLKPQPV AVKLLDLDGLQGHREWLAILLLCRGRKE


| Top |